Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A219ASP1

Protein Details
Accession A0A219ASP1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
72-96EQSSQTKLWRGKKKVKYGVAWRRMLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 7, nucl 5, pero 2
Family & Domain DBs
Amino Acid Sequences MVVCWDQQGQLAQGYGPAWNDRQLIKKSRGYNRPCGVERTKGRTFWCAAEIFLSHFCLLLVRWMKEASPSTEQSSQTKLWRGKKKVKYGVAWRRMLDAALAPSLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.12
6 0.15
7 0.17
8 0.19
9 0.26
10 0.31
11 0.37
12 0.41
13 0.46
14 0.52
15 0.59
16 0.66
17 0.65
18 0.69
19 0.67
20 0.68
21 0.63
22 0.61
23 0.55
24 0.55
25 0.54
26 0.52
27 0.49
28 0.46
29 0.45
30 0.42
31 0.4
32 0.32
33 0.3
34 0.22
35 0.19
36 0.17
37 0.15
38 0.13
39 0.12
40 0.11
41 0.08
42 0.08
43 0.07
44 0.07
45 0.06
46 0.11
47 0.14
48 0.14
49 0.15
50 0.15
51 0.15
52 0.19
53 0.21
54 0.19
55 0.21
56 0.22
57 0.26
58 0.3
59 0.32
60 0.3
61 0.32
62 0.31
63 0.3
64 0.36
65 0.39
66 0.44
67 0.53
68 0.59
69 0.66
70 0.72
71 0.79
72 0.81
73 0.81
74 0.8
75 0.81
76 0.84
77 0.82
78 0.78
79 0.68
80 0.62
81 0.55
82 0.46
83 0.37
84 0.29
85 0.22