Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DA42

Protein Details
Accession J9DA42    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-36IYRSLACSQKPKKTMKFYHNGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036168  AP2_Mu_C_sf  
Amino Acid Sequences MEEDYIIKNPKDVVIYRSLACSQKPKKTMKFYHNGLEFVSAYFDKLLQKYFILEKMGFLKNTTSHHSLPKLISKMSISPLGQNNENNVLCKLEQKASKIVQSRDILIDIEENMFIIFQDDKLITSTIVGKLMLKKAFDERFVVSFSSKGCVEDISAVFTNKNGDEVELRHKTFLTYSRKPSSSELPIKIKFDKLNNLLYIENNCKSEIKNIKINFPLKHSTYKASATSFGAKSNVKIDETSINWVIYELNTFGENRKASLKIDENEIPNSDTRGRVILFDFEVDMWCDAGIEINHVKCGEEKCKDVFVATSCKAKKFEYRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.33
4 0.35
5 0.36
6 0.34
7 0.36
8 0.42
9 0.43
10 0.49
11 0.56
12 0.62
13 0.67
14 0.75
15 0.81
16 0.81
17 0.82
18 0.78
19 0.79
20 0.73
21 0.64
22 0.54
23 0.49
24 0.39
25 0.29
26 0.28
27 0.19
28 0.15
29 0.15
30 0.16
31 0.16
32 0.17
33 0.19
34 0.17
35 0.18
36 0.2
37 0.23
38 0.24
39 0.24
40 0.23
41 0.23
42 0.27
43 0.31
44 0.28
45 0.26
46 0.26
47 0.25
48 0.28
49 0.32
50 0.31
51 0.3
52 0.36
53 0.38
54 0.39
55 0.39
56 0.43
57 0.39
58 0.35
59 0.34
60 0.3
61 0.3
62 0.29
63 0.31
64 0.23
65 0.26
66 0.31
67 0.32
68 0.33
69 0.32
70 0.31
71 0.33
72 0.33
73 0.29
74 0.24
75 0.23
76 0.2
77 0.22
78 0.22
79 0.21
80 0.23
81 0.25
82 0.31
83 0.31
84 0.37
85 0.4
86 0.39
87 0.4
88 0.39
89 0.38
90 0.32
91 0.31
92 0.25
93 0.19
94 0.18
95 0.11
96 0.1
97 0.08
98 0.07
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.04
105 0.06
106 0.06
107 0.07
108 0.08
109 0.09
110 0.07
111 0.08
112 0.1
113 0.09
114 0.1
115 0.1
116 0.1
117 0.13
118 0.17
119 0.18
120 0.16
121 0.17
122 0.23
123 0.24
124 0.24
125 0.24
126 0.21
127 0.2
128 0.21
129 0.21
130 0.14
131 0.14
132 0.13
133 0.12
134 0.11
135 0.1
136 0.09
137 0.09
138 0.09
139 0.1
140 0.1
141 0.11
142 0.12
143 0.11
144 0.11
145 0.11
146 0.12
147 0.09
148 0.1
149 0.07
150 0.07
151 0.08
152 0.1
153 0.17
154 0.2
155 0.2
156 0.2
157 0.2
158 0.19
159 0.2
160 0.26
161 0.28
162 0.29
163 0.36
164 0.41
165 0.42
166 0.44
167 0.45
168 0.42
169 0.42
170 0.43
171 0.42
172 0.43
173 0.44
174 0.45
175 0.44
176 0.42
177 0.36
178 0.33
179 0.35
180 0.32
181 0.34
182 0.32
183 0.32
184 0.29
185 0.27
186 0.27
187 0.24
188 0.23
189 0.19
190 0.19
191 0.19
192 0.19
193 0.26
194 0.3
195 0.3
196 0.36
197 0.36
198 0.41
199 0.47
200 0.51
201 0.44
202 0.41
203 0.42
204 0.38
205 0.43
206 0.39
207 0.36
208 0.34
209 0.36
210 0.33
211 0.3
212 0.29
213 0.25
214 0.29
215 0.26
216 0.24
217 0.24
218 0.23
219 0.22
220 0.24
221 0.24
222 0.19
223 0.19
224 0.19
225 0.2
226 0.21
227 0.25
228 0.22
229 0.2
230 0.19
231 0.19
232 0.18
233 0.13
234 0.13
235 0.09
236 0.08
237 0.09
238 0.09
239 0.11
240 0.16
241 0.17
242 0.17
243 0.2
244 0.21
245 0.21
246 0.28
247 0.34
248 0.29
249 0.35
250 0.38
251 0.37
252 0.38
253 0.38
254 0.33
255 0.26
256 0.28
257 0.24
258 0.2
259 0.19
260 0.2
261 0.19
262 0.19
263 0.2
264 0.19
265 0.18
266 0.18
267 0.17
268 0.14
269 0.15
270 0.14
271 0.13
272 0.1
273 0.09
274 0.08
275 0.07
276 0.1
277 0.09
278 0.12
279 0.16
280 0.17
281 0.19
282 0.19
283 0.2
284 0.21
285 0.28
286 0.32
287 0.32
288 0.36
289 0.37
290 0.41
291 0.41
292 0.38
293 0.35
294 0.3
295 0.35
296 0.33
297 0.39
298 0.38
299 0.43
300 0.44
301 0.45