Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179F134

Protein Details
Accession A0A179F134    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-125LEARHGKKNRTARKCGKKGKKCLRRGKKHRKGKKKNKKAKKVKKANKANAYBasic
NLS Segment(s)
PositionSequence
78-121RHGKKNRTARKCGKKGKKCLRRGKKHRKGKKKNKKAKKVKKANK
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MKILNTFYLVAFFVSGALAVPMTGDVIDAGKRDASANSIGLSEAAQPGAGDVPNIRSVLGRNADGESEVAEASELEARHGKKNRTARKCGKKGKKCLRRGKKHRKGKKKNKKAKKVKKANKANAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.05
14 0.06
15 0.06
16 0.07
17 0.07
18 0.07
19 0.08
20 0.08
21 0.1
22 0.11
23 0.11
24 0.11
25 0.11
26 0.1
27 0.1
28 0.1
29 0.08
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.06
36 0.05
37 0.04
38 0.04
39 0.06
40 0.08
41 0.08
42 0.08
43 0.08
44 0.09
45 0.13
46 0.14
47 0.13
48 0.12
49 0.12
50 0.12
51 0.12
52 0.11
53 0.07
54 0.06
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.07
61 0.06
62 0.07
63 0.11
64 0.13
65 0.2
66 0.26
67 0.28
68 0.33
69 0.43
70 0.53
71 0.58
72 0.66
73 0.7
74 0.76
75 0.84
76 0.87
77 0.88
78 0.88
79 0.9
80 0.91
81 0.91
82 0.9
83 0.91
84 0.92
85 0.92
86 0.94
87 0.94
88 0.94
89 0.95
90 0.95
91 0.95
92 0.96
93 0.96
94 0.96
95 0.96
96 0.96
97 0.96
98 0.97
99 0.97
100 0.97
101 0.96
102 0.96
103 0.95
104 0.95
105 0.95