Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A219AS85

Protein Details
Accession A0A219AS85    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-44LIDIPRWNKHHNPRCKHHPPPGDLEBasic
NLS Segment(s)
Subcellular Location(s) cysk 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MLNLQNLPLEIRLLIYEHTLIDIPRWNKHHNPRCKHHPPPGDLERPPFLSIYMTICPENKTIQTSPFCSCAKRTGLSLLQTTRSINAEASPVFWSKNTFCLLDGRDLTVAVGHILRRETAQRIKRISIMNPDRRGFTEHIRGGLRVRGARRAEFWDAVLQCTRLESLEIPLSYIKGKGMGRIVRELVEKVVGLRGLELTRLVPYCWKDTVCGYPFPSSNFMSFPAVYVRCSRRMLLGDYVGDEAIASTCREIESNFYVHVDSVVKTQYLGAEEHRMEAWRDMIKLAPGLHSHENTRTIKLPAGETTLITFYGLPVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.11
5 0.12
6 0.12
7 0.12
8 0.13
9 0.2
10 0.21
11 0.28
12 0.33
13 0.38
14 0.46
15 0.58
16 0.65
17 0.68
18 0.75
19 0.78
20 0.84
21 0.88
22 0.87
23 0.86
24 0.85
25 0.8
26 0.8
27 0.79
28 0.77
29 0.7
30 0.66
31 0.59
32 0.53
33 0.48
34 0.38
35 0.3
36 0.23
37 0.21
38 0.2
39 0.18
40 0.18
41 0.18
42 0.19
43 0.21
44 0.21
45 0.22
46 0.2
47 0.24
48 0.24
49 0.29
50 0.32
51 0.34
52 0.34
53 0.37
54 0.37
55 0.33
56 0.33
57 0.33
58 0.33
59 0.31
60 0.3
61 0.3
62 0.33
63 0.34
64 0.37
65 0.33
66 0.31
67 0.31
68 0.3
69 0.25
70 0.22
71 0.2
72 0.15
73 0.14
74 0.14
75 0.13
76 0.14
77 0.14
78 0.13
79 0.13
80 0.13
81 0.15
82 0.14
83 0.18
84 0.18
85 0.17
86 0.17
87 0.21
88 0.22
89 0.24
90 0.24
91 0.21
92 0.19
93 0.18
94 0.17
95 0.13
96 0.11
97 0.07
98 0.07
99 0.06
100 0.07
101 0.08
102 0.08
103 0.09
104 0.12
105 0.16
106 0.24
107 0.3
108 0.35
109 0.38
110 0.39
111 0.43
112 0.43
113 0.41
114 0.43
115 0.46
116 0.48
117 0.51
118 0.5
119 0.46
120 0.45
121 0.46
122 0.37
123 0.33
124 0.33
125 0.28
126 0.31
127 0.3
128 0.29
129 0.26
130 0.26
131 0.24
132 0.18
133 0.19
134 0.22
135 0.23
136 0.24
137 0.25
138 0.27
139 0.27
140 0.25
141 0.24
142 0.22
143 0.2
144 0.21
145 0.19
146 0.15
147 0.12
148 0.12
149 0.11
150 0.06
151 0.07
152 0.06
153 0.07
154 0.1
155 0.1
156 0.1
157 0.1
158 0.11
159 0.11
160 0.11
161 0.08
162 0.1
163 0.1
164 0.12
165 0.17
166 0.19
167 0.21
168 0.23
169 0.23
170 0.2
171 0.21
172 0.2
173 0.15
174 0.13
175 0.11
176 0.09
177 0.1
178 0.08
179 0.07
180 0.07
181 0.08
182 0.07
183 0.08
184 0.08
185 0.07
186 0.08
187 0.09
188 0.09
189 0.12
190 0.14
191 0.16
192 0.18
193 0.18
194 0.18
195 0.2
196 0.27
197 0.26
198 0.27
199 0.26
200 0.27
201 0.28
202 0.29
203 0.3
204 0.24
205 0.23
206 0.2
207 0.2
208 0.19
209 0.18
210 0.17
211 0.18
212 0.18
213 0.18
214 0.24
215 0.25
216 0.28
217 0.3
218 0.3
219 0.29
220 0.31
221 0.34
222 0.31
223 0.3
224 0.26
225 0.25
226 0.25
227 0.2
228 0.16
229 0.13
230 0.09
231 0.07
232 0.07
233 0.06
234 0.05
235 0.06
236 0.07
237 0.07
238 0.07
239 0.12
240 0.14
241 0.16
242 0.16
243 0.17
244 0.17
245 0.16
246 0.18
247 0.14
248 0.12
249 0.13
250 0.14
251 0.13
252 0.12
253 0.13
254 0.13
255 0.14
256 0.14
257 0.14
258 0.2
259 0.2
260 0.22
261 0.22
262 0.21
263 0.21
264 0.22
265 0.24
266 0.2
267 0.2
268 0.2
269 0.2
270 0.21
271 0.22
272 0.21
273 0.2
274 0.19
275 0.24
276 0.29
277 0.29
278 0.31
279 0.33
280 0.4
281 0.38
282 0.41
283 0.39
284 0.36
285 0.37
286 0.37
287 0.35
288 0.3
289 0.33
290 0.3
291 0.27
292 0.27
293 0.24
294 0.22
295 0.19
296 0.16