Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179G5I0

Protein Details
Accession A0A179G5I0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
34-57QAALHKRHGPKRKPRMPQGFTNKIHydrophilic
NLS Segment(s)
PositionSequence
39-48KRHGPKRKPR
Subcellular Location(s) extr 11, cyto 5, cyto_nucl 5, nucl 3, mito 3, E.R. 2
Family & Domain DBs
Amino Acid Sequences MQVEHHGNHAVCDGLTVNLLLLCITVHQTAPMYQAALHKRHGPKRKPRMPQGFTNKIAGAANLDHVHESPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.06
6 0.06
7 0.05
8 0.04
9 0.04
10 0.04
11 0.06
12 0.06
13 0.06
14 0.07
15 0.07
16 0.08
17 0.1
18 0.1
19 0.08
20 0.09
21 0.14
22 0.17
23 0.19
24 0.19
25 0.24
26 0.31
27 0.39
28 0.48
29 0.52
30 0.6
31 0.69
32 0.77
33 0.79
34 0.83
35 0.86
36 0.81
37 0.82
38 0.81
39 0.78
40 0.71
41 0.66
42 0.55
43 0.46
44 0.41
45 0.31
46 0.24
47 0.16
48 0.18
49 0.15
50 0.16
51 0.15