Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179FNA0

Protein Details
Accession A0A179FNA0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-91GAVSKKREKKEIFNDHDRRGBasic
NLS Segment(s)
PositionSequence
76-80KKREK
Subcellular Location(s) cyto_nucl 12, nucl 10.5, cyto 10.5, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MVGGDDVHRNIAISDIQHRCSMLDGRAGCGGAGHLRGAWRSMLPNCSSSCKPASLPAYPPSQEAEIGNKERGAVSKKREKKEIFNDHDRRGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.24
4 0.24
5 0.24
6 0.23
7 0.24
8 0.25
9 0.18
10 0.21
11 0.19
12 0.2
13 0.21
14 0.21
15 0.18
16 0.14
17 0.13
18 0.09
19 0.09
20 0.07
21 0.07
22 0.07
23 0.08
24 0.09
25 0.09
26 0.08
27 0.1
28 0.12
29 0.14
30 0.15
31 0.17
32 0.17
33 0.21
34 0.21
35 0.21
36 0.21
37 0.19
38 0.18
39 0.21
40 0.24
41 0.22
42 0.25
43 0.26
44 0.28
45 0.28
46 0.28
47 0.24
48 0.22
49 0.2
50 0.18
51 0.2
52 0.21
53 0.23
54 0.23
55 0.21
56 0.21
57 0.21
58 0.24
59 0.25
60 0.26
61 0.31
62 0.41
63 0.5
64 0.56
65 0.65
66 0.66
67 0.71
68 0.75
69 0.78
70 0.76
71 0.78
72 0.8