Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D732

Protein Details
Accession J9D732    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-126EQKNTLTWRERIRKRKYKKQYFAYVEPQQSHydrophilic
NLS Segment(s)
PositionSequence
63-89KRLVNAIKKYRNAKLLPKDMRPKKTRA
107-114RIRKRKYK
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MAKLIPMSRLRNKTEENLLKLLSEHKNELLKLRQQKVSGNVKPTDFTKERRNVARILTQIRHKRLVNAIKKYRNAKLLPKDMRPKKTRAQRLMLTEEQKNTLTWRERIRKRKYKKQYFAYVEPQQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.6
3 0.56
4 0.52
5 0.48
6 0.41
7 0.38
8 0.39
9 0.34
10 0.29
11 0.26
12 0.28
13 0.31
14 0.31
15 0.36
16 0.35
17 0.37
18 0.43
19 0.47
20 0.46
21 0.44
22 0.48
23 0.52
24 0.56
25 0.52
26 0.49
27 0.46
28 0.42
29 0.42
30 0.39
31 0.39
32 0.31
33 0.31
34 0.35
35 0.39
36 0.43
37 0.47
38 0.48
39 0.42
40 0.43
41 0.44
42 0.38
43 0.36
44 0.34
45 0.37
46 0.41
47 0.42
48 0.44
49 0.39
50 0.38
51 0.41
52 0.47
53 0.47
54 0.5
55 0.54
56 0.55
57 0.6
58 0.62
59 0.59
60 0.56
61 0.52
62 0.51
63 0.51
64 0.55
65 0.55
66 0.59
67 0.65
68 0.66
69 0.72
70 0.68
71 0.65
72 0.64
73 0.69
74 0.72
75 0.69
76 0.69
77 0.65
78 0.67
79 0.68
80 0.65
81 0.59
82 0.53
83 0.47
84 0.42
85 0.37
86 0.31
87 0.26
88 0.28
89 0.29
90 0.31
91 0.39
92 0.47
93 0.56
94 0.66
95 0.75
96 0.78
97 0.83
98 0.89
99 0.9
100 0.91
101 0.92
102 0.91
103 0.91
104 0.89
105 0.86
106 0.85