Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A219ARS7

Protein Details
Accession A0A219ARS7    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-47VKTGHKTRLLQKTQKRQPSHCKKRSNLCPDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MPTDTSTSRPPSTQRWVKTGHKTRLLQKTQKRQPSHCKKRSNLCPDSSNVPIVTPAMHETRLNGPPPQYPIEGERSVKSPNPSTWQSLPLLFFARLAQTIAFDAHTING
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.56
4 0.61
5 0.68
6 0.71
7 0.69
8 0.69
9 0.7
10 0.73
11 0.77
12 0.77
13 0.75
14 0.75
15 0.77
16 0.77
17 0.82
18 0.79
19 0.76
20 0.79
21 0.81
22 0.83
23 0.81
24 0.81
25 0.78
26 0.83
27 0.84
28 0.83
29 0.77
30 0.7
31 0.64
32 0.57
33 0.54
34 0.45
35 0.36
36 0.26
37 0.2
38 0.16
39 0.13
40 0.11
41 0.07
42 0.08
43 0.08
44 0.09
45 0.08
46 0.1
47 0.15
48 0.18
49 0.19
50 0.18
51 0.19
52 0.2
53 0.24
54 0.24
55 0.2
56 0.18
57 0.2
58 0.25
59 0.26
60 0.25
61 0.23
62 0.23
63 0.25
64 0.27
65 0.28
66 0.26
67 0.27
68 0.32
69 0.34
70 0.37
71 0.37
72 0.37
73 0.35
74 0.33
75 0.3
76 0.26
77 0.26
78 0.21
79 0.19
80 0.16
81 0.17
82 0.15
83 0.15
84 0.13
85 0.11
86 0.12
87 0.12
88 0.12
89 0.1