Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179FA74

Protein Details
Accession A0A179FA74   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-45TTTTTRPRRRGLFSRRPRHVHHQKRKPTMKDKVSBasic
NLS Segment(s)
PositionSequence
17-70RPRRRGLFSRRPRHVHHQKRKPTMKDKVSGALMKIRGSLTRRPGLKAAGTRRMH
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPFGRRTHHHHTTTTTRPRRRGLFSRRPRHVHHQKRKPTMKDKVSGALMKIRGSLTRRPGLKAAGTRRMHGTDGRGHHKHAHIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.67
4 0.69
5 0.73
6 0.72
7 0.72
8 0.72
9 0.72
10 0.73
11 0.76
12 0.8
13 0.81
14 0.8
15 0.78
16 0.79
17 0.79
18 0.79
19 0.8
20 0.8
21 0.81
22 0.86
23 0.89
24 0.86
25 0.84
26 0.82
27 0.77
28 0.71
29 0.63
30 0.56
31 0.51
32 0.43
33 0.35
34 0.29
35 0.25
36 0.2
37 0.2
38 0.16
39 0.17
40 0.2
41 0.24
42 0.26
43 0.31
44 0.33
45 0.34
46 0.36
47 0.35
48 0.37
49 0.39
50 0.4
51 0.44
52 0.44
53 0.44
54 0.46
55 0.45
56 0.42
57 0.37
58 0.34
59 0.32
60 0.38
61 0.45
62 0.42
63 0.43
64 0.48