Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179F668

Protein Details
Accession A0A179F668   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
125-145SLSRRWSWPWGKSHRKKCESWHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, golg 6, mito 2, cyto 1, plas 1, E.R. 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR036444  PLipase_A2_dom_sf  
IPR015141  PLipase_A2_prok/fun  
Gene Ontology GO:0004623  F:phospholipase A2 activity  
GO:0050482  P:arachidonic acid secretion  
GO:0006644  P:phospholipid metabolic process  
Pfam View protein in Pfam  
PF09056  Phospholip_A2_3  
Amino Acid Sequences MKAVICVLVTLAAVSGASPSPSFLRQEDSRCTDAGKIAEVDRLLFQVDMATFTKVRDAKNPSCLDWSSDGCSHSPDKPSGFDFKPCCRRHDFGYRNAKAQNRCSHNLRKRIDQNLKEDMLRVCGSLSRRWSWPWGKSHRKKCESWAENYYDGVRNWGRGSCGPRVPDKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.05
4 0.06
5 0.06
6 0.08
7 0.11
8 0.13
9 0.16
10 0.15
11 0.22
12 0.26
13 0.31
14 0.37
15 0.4
16 0.4
17 0.38
18 0.38
19 0.32
20 0.31
21 0.27
22 0.22
23 0.17
24 0.16
25 0.18
26 0.17
27 0.17
28 0.13
29 0.13
30 0.12
31 0.1
32 0.09
33 0.08
34 0.08
35 0.1
36 0.1
37 0.11
38 0.11
39 0.11
40 0.17
41 0.18
42 0.19
43 0.24
44 0.31
45 0.33
46 0.42
47 0.43
48 0.39
49 0.4
50 0.39
51 0.35
52 0.3
53 0.28
54 0.22
55 0.22
56 0.22
57 0.18
58 0.2
59 0.19
60 0.18
61 0.19
62 0.18
63 0.17
64 0.18
65 0.2
66 0.23
67 0.22
68 0.25
69 0.27
70 0.33
71 0.42
72 0.42
73 0.44
74 0.44
75 0.45
76 0.44
77 0.52
78 0.49
79 0.48
80 0.58
81 0.55
82 0.53
83 0.55
84 0.54
85 0.47
86 0.5
87 0.49
88 0.44
89 0.47
90 0.51
91 0.57
92 0.6
93 0.65
94 0.61
95 0.62
96 0.63
97 0.69
98 0.72
99 0.67
100 0.65
101 0.61
102 0.6
103 0.51
104 0.46
105 0.36
106 0.31
107 0.25
108 0.2
109 0.14
110 0.15
111 0.18
112 0.2
113 0.24
114 0.23
115 0.25
116 0.27
117 0.35
118 0.39
119 0.44
120 0.49
121 0.55
122 0.63
123 0.71
124 0.8
125 0.82
126 0.82
127 0.78
128 0.78
129 0.78
130 0.72
131 0.69
132 0.66
133 0.6
134 0.55
135 0.53
136 0.48
137 0.41
138 0.35
139 0.35
140 0.28
141 0.25
142 0.26
143 0.26
144 0.27
145 0.28
146 0.33
147 0.34
148 0.39
149 0.4