Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DV68

Protein Details
Accession J9DV68    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-35QKFGSSSRITKRFRKNNKRWVGIQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 14
Family & Domain DBs
Amino Acid Sequences MGAAGLIPRSVQKFGSSSRITKRFRKNNKRWVGIQGGSHEPPVTKAPTVVIFSGVLEELANFFGPHTNTVEEKAGMKSLPGRRENVLITSEACGRGLVDTPSACG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.31
3 0.31
4 0.34
5 0.42
6 0.51
7 0.54
8 0.6
9 0.68
10 0.69
11 0.77
12 0.83
13 0.84
14 0.86
15 0.9
16 0.87
17 0.79
18 0.74
19 0.7
20 0.61
21 0.53
22 0.46
23 0.4
24 0.35
25 0.32
26 0.26
27 0.18
28 0.18
29 0.18
30 0.16
31 0.11
32 0.11
33 0.12
34 0.14
35 0.15
36 0.13
37 0.11
38 0.1
39 0.09
40 0.1
41 0.08
42 0.06
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.06
51 0.07
52 0.08
53 0.1
54 0.11
55 0.12
56 0.14
57 0.16
58 0.14
59 0.15
60 0.15
61 0.14
62 0.12
63 0.12
64 0.18
65 0.22
66 0.3
67 0.31
68 0.33
69 0.34
70 0.38
71 0.39
72 0.34
73 0.3
74 0.23
75 0.21
76 0.2
77 0.21
78 0.18
79 0.17
80 0.14
81 0.12
82 0.13
83 0.14
84 0.13
85 0.14