Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179FSG1

Protein Details
Accession A0A179FSG1   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MASDHPTPKTERRNRKERRNIKTSITHydrophilic
NLS Segment(s)
PositionSequence
13-18RNRKER
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MASDHPTPKTERRNRKERRNIKTSITSNSNSNSNSNLGRSSQYRQNFLGSLDSDLHVANYHPRRPHNCAKSKSQSPVSSCCCQLRTRRHQLPIYPLIPSGVLQNTQRPAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.89
3 0.92
4 0.91
5 0.9
6 0.86
7 0.81
8 0.77
9 0.77
10 0.69
11 0.65
12 0.6
13 0.52
14 0.47
15 0.45
16 0.41
17 0.33
18 0.3
19 0.25
20 0.22
21 0.21
22 0.2
23 0.19
24 0.16
25 0.17
26 0.19
27 0.21
28 0.26
29 0.28
30 0.3
31 0.29
32 0.3
33 0.28
34 0.26
35 0.24
36 0.18
37 0.16
38 0.14
39 0.13
40 0.12
41 0.11
42 0.1
43 0.07
44 0.07
45 0.12
46 0.16
47 0.19
48 0.22
49 0.27
50 0.32
51 0.4
52 0.49
53 0.52
54 0.58
55 0.59
56 0.65
57 0.69
58 0.69
59 0.68
60 0.66
61 0.61
62 0.55
63 0.59
64 0.55
65 0.5
66 0.47
67 0.44
68 0.39
69 0.39
70 0.44
71 0.47
72 0.52
73 0.59
74 0.65
75 0.69
76 0.73
77 0.73
78 0.73
79 0.7
80 0.61
81 0.52
82 0.44
83 0.36
84 0.31
85 0.26
86 0.21
87 0.15
88 0.17
89 0.18
90 0.24