Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DK85

Protein Details
Accession J9DK85    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
91-117AITELRTCLNRKKKRKKFYWYFIYFFIHydrophilic
NLS Segment(s)
PositionSequence
101-107RKKKRKK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, mito 2, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKSDKNVKNIELQENKSTSKETQSHVLTLQSMVDDISFAESRKKKIEEVNKKTDEVIQLQNYIDCIVKVQGEIIDNIYYRMCKNEEEADKAITELRTCLNRKKKRKKFYWYFIYFFIILAVFLIIKAIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.45
4 0.43
5 0.35
6 0.36
7 0.36
8 0.32
9 0.36
10 0.37
11 0.37
12 0.35
13 0.34
14 0.27
15 0.23
16 0.2
17 0.12
18 0.1
19 0.08
20 0.07
21 0.05
22 0.05
23 0.08
24 0.08
25 0.08
26 0.16
27 0.19
28 0.22
29 0.27
30 0.29
31 0.29
32 0.36
33 0.47
34 0.5
35 0.56
36 0.63
37 0.6
38 0.59
39 0.57
40 0.51
41 0.42
42 0.34
43 0.3
44 0.22
45 0.2
46 0.2
47 0.19
48 0.17
49 0.15
50 0.12
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.09
64 0.09
65 0.09
66 0.08
67 0.11
68 0.1
69 0.1
70 0.13
71 0.2
72 0.23
73 0.28
74 0.29
75 0.28
76 0.26
77 0.26
78 0.25
79 0.18
80 0.15
81 0.11
82 0.13
83 0.19
84 0.22
85 0.31
86 0.4
87 0.5
88 0.61
89 0.71
90 0.79
91 0.83
92 0.9
93 0.92
94 0.92
95 0.92
96 0.92
97 0.88
98 0.8
99 0.72
100 0.66
101 0.55
102 0.44
103 0.34
104 0.23
105 0.15
106 0.13
107 0.1
108 0.06
109 0.05