Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A219ANX7

Protein Details
Accession A0A219ANX7    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
224-246DEAPEPAPKRQRRGSRRVPAASVHydrophilic
NLS Segment(s)
PositionSequence
184-208KVTRKKAALGPGKQTGVRQAGRRRQ
231-240PKRQRRGSRR
Subcellular Location(s) nucl 18, mito 5, cysk 2
Family & Domain DBs
Amino Acid Sequences MSNLYGLVEAIEGMLADQQQDFLDNCSQDEVLTARAYSGPGSEYLGELRMVMSQPGLSLLAREHRHAVKSIPSRSCPWPEPIGKCNEDCTVSWQLGIPCSHTIYNKLEAGTFLTKWDVHPRWHLREPTSRNPYRRILDPKVATSLRGRPKNATQPVPESMVINRPASQSRDGLAATGKTIKESKVTRKKAALGPGKQTGVRQAGRRRQLSVRRTRSEWEIISEDEAPEPAPKRQRRGSRRVPAASVSSAAKARTHYTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.06
5 0.07
6 0.07
7 0.09
8 0.1
9 0.12
10 0.16
11 0.16
12 0.17
13 0.18
14 0.18
15 0.16
16 0.17
17 0.14
18 0.12
19 0.13
20 0.12
21 0.11
22 0.12
23 0.12
24 0.11
25 0.11
26 0.09
27 0.09
28 0.11
29 0.11
30 0.11
31 0.11
32 0.12
33 0.11
34 0.1
35 0.1
36 0.09
37 0.09
38 0.09
39 0.08
40 0.07
41 0.07
42 0.08
43 0.09
44 0.07
45 0.07
46 0.08
47 0.16
48 0.17
49 0.19
50 0.22
51 0.24
52 0.26
53 0.27
54 0.28
55 0.3
56 0.36
57 0.42
58 0.42
59 0.42
60 0.45
61 0.49
62 0.52
63 0.46
64 0.42
65 0.42
66 0.44
67 0.46
68 0.46
69 0.48
70 0.44
71 0.42
72 0.4
73 0.35
74 0.3
75 0.26
76 0.26
77 0.22
78 0.2
79 0.2
80 0.19
81 0.18
82 0.19
83 0.19
84 0.15
85 0.13
86 0.15
87 0.16
88 0.15
89 0.18
90 0.18
91 0.21
92 0.2
93 0.19
94 0.18
95 0.17
96 0.2
97 0.17
98 0.14
99 0.12
100 0.12
101 0.11
102 0.12
103 0.21
104 0.2
105 0.2
106 0.29
107 0.34
108 0.39
109 0.45
110 0.47
111 0.42
112 0.49
113 0.54
114 0.55
115 0.58
116 0.57
117 0.54
118 0.56
119 0.57
120 0.51
121 0.51
122 0.49
123 0.44
124 0.47
125 0.46
126 0.42
127 0.42
128 0.39
129 0.34
130 0.28
131 0.32
132 0.33
133 0.36
134 0.37
135 0.35
136 0.41
137 0.49
138 0.52
139 0.49
140 0.43
141 0.42
142 0.43
143 0.42
144 0.37
145 0.28
146 0.23
147 0.24
148 0.23
149 0.2
150 0.19
151 0.18
152 0.2
153 0.22
154 0.23
155 0.19
156 0.17
157 0.19
158 0.17
159 0.16
160 0.15
161 0.12
162 0.11
163 0.14
164 0.13
165 0.13
166 0.15
167 0.15
168 0.2
169 0.25
170 0.35
171 0.42
172 0.48
173 0.51
174 0.55
175 0.6
176 0.59
177 0.63
178 0.62
179 0.56
180 0.56
181 0.55
182 0.53
183 0.48
184 0.43
185 0.4
186 0.37
187 0.37
188 0.38
189 0.43
190 0.5
191 0.57
192 0.59
193 0.58
194 0.6
195 0.65
196 0.68
197 0.69
198 0.7
199 0.68
200 0.68
201 0.67
202 0.64
203 0.61
204 0.53
205 0.47
206 0.4
207 0.35
208 0.35
209 0.32
210 0.26
211 0.2
212 0.19
213 0.14
214 0.15
215 0.17
216 0.21
217 0.3
218 0.35
219 0.43
220 0.52
221 0.62
222 0.68
223 0.76
224 0.81
225 0.82
226 0.86
227 0.83
228 0.77
229 0.71
230 0.65
231 0.57
232 0.48
233 0.39
234 0.33
235 0.29
236 0.27
237 0.25
238 0.23