Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DLY7

Protein Details
Accession J9DLY7   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MEKHKGLRSKRFKHVYKINVDBasic
NLS Segment(s)
Subcellular Location(s) E.R. 10, mito 6, golg 4, mito_nucl 4, nucl 2, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002109  Glutaredoxin  
IPR014025  Glutaredoxin_subgr  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00462  Glutaredoxin  
PROSITE View protein in PROSITE  
PS51354  GLUTAREDOXIN_2  
CDD cd02066  GRX_family  
Amino Acid Sequences MEKHKGLRSKRFKHVYKINVDMISILLLTLAGLIAQKFKSEIDVQKVHIKQNNVIETSVLSEFSKKAEAVVIGRQGCPFCEGAVMLLMANKVDFAYYSAENHGYLRDEAFKLYNHRTVPVIFLNNAFVGGFKELNERFAHEECC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.78
4 0.75
5 0.7
6 0.6
7 0.54
8 0.44
9 0.34
10 0.26
11 0.18
12 0.11
13 0.05
14 0.04
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.06
22 0.07
23 0.07
24 0.08
25 0.08
26 0.11
27 0.16
28 0.2
29 0.25
30 0.27
31 0.29
32 0.37
33 0.39
34 0.4
35 0.39
36 0.37
37 0.34
38 0.38
39 0.4
40 0.33
41 0.31
42 0.26
43 0.23
44 0.23
45 0.19
46 0.13
47 0.09
48 0.08
49 0.09
50 0.09
51 0.11
52 0.08
53 0.08
54 0.08
55 0.09
56 0.09
57 0.11
58 0.15
59 0.14
60 0.15
61 0.15
62 0.14
63 0.14
64 0.14
65 0.12
66 0.08
67 0.07
68 0.07
69 0.06
70 0.07
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.03
80 0.04
81 0.04
82 0.08
83 0.08
84 0.1
85 0.11
86 0.12
87 0.13
88 0.13
89 0.13
90 0.12
91 0.12
92 0.12
93 0.14
94 0.14
95 0.15
96 0.16
97 0.18
98 0.21
99 0.25
100 0.3
101 0.27
102 0.28
103 0.29
104 0.27
105 0.29
106 0.28
107 0.27
108 0.22
109 0.22
110 0.23
111 0.21
112 0.21
113 0.16
114 0.12
115 0.1
116 0.12
117 0.11
118 0.1
119 0.18
120 0.18
121 0.21
122 0.22
123 0.23
124 0.26