Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8ZVI2

Protein Details
Accession J8ZVI2   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-131KSSKMSKATKDQKDKKDGKKDKKDDKKDKKKEPKKNGAKDAVMSBasic
NLS Segment(s)
PositionSequence
94-125KATKDQKDKKDGKKDKKDDKKDKKKEPKKNGA
Subcellular Location(s) E.R. 8, nucl 4, golg 4, mito 3, extr 3, vacu 3
Family & Domain DBs
Amino Acid Sequences MHKLVYLFLLALTFAKPERSGKSKMMESESDSDEKQSLKRKSQLKKYSDKTNPSMGRNALAGAKSNNEEDEEEEEEEKQDYVDDEDEKSSKMSKATKDQKDKKDGKKDKKDDKKDKKKEPKKNGAKDAVMSVALVTLILSCISAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.12
4 0.16
5 0.22
6 0.27
7 0.31
8 0.35
9 0.41
10 0.43
11 0.46
12 0.47
13 0.42
14 0.41
15 0.41
16 0.39
17 0.34
18 0.3
19 0.27
20 0.23
21 0.23
22 0.23
23 0.28
24 0.3
25 0.35
26 0.42
27 0.5
28 0.57
29 0.67
30 0.72
31 0.7
32 0.74
33 0.73
34 0.76
35 0.76
36 0.73
37 0.66
38 0.66
39 0.63
40 0.56
41 0.54
42 0.44
43 0.37
44 0.31
45 0.28
46 0.2
47 0.15
48 0.14
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.1
55 0.1
56 0.1
57 0.12
58 0.13
59 0.12
60 0.12
61 0.12
62 0.11
63 0.11
64 0.1
65 0.07
66 0.05
67 0.05
68 0.06
69 0.07
70 0.08
71 0.08
72 0.09
73 0.1
74 0.1
75 0.1
76 0.11
77 0.11
78 0.14
79 0.18
80 0.21
81 0.32
82 0.41
83 0.5
84 0.6
85 0.68
86 0.72
87 0.78
88 0.83
89 0.82
90 0.84
91 0.85
92 0.85
93 0.87
94 0.88
95 0.89
96 0.91
97 0.92
98 0.92
99 0.94
100 0.94
101 0.93
102 0.95
103 0.95
104 0.95
105 0.95
106 0.94
107 0.94
108 0.94
109 0.93
110 0.92
111 0.89
112 0.81
113 0.72
114 0.63
115 0.54
116 0.43
117 0.32
118 0.22
119 0.14
120 0.11
121 0.09
122 0.06
123 0.04
124 0.04
125 0.05