Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179G7M1

Protein Details
Accession A0A179G7M1   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
125-146QKPHPSAKGKSKSKPRHDKAAABasic
NLS Segment(s)
PositionSequence
129-143PSAKGKSKSKPRHDK
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 9.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000014  PAS  
IPR035965  PAS-like_dom_sf  
Pfam View protein in Pfam  
PF13426  PAS_9  
PROSITE View protein in PROSITE  
PS50112  PAS  
CDD cd00130  PAS  
Amino Acid Sequences MASNMEIAMNPWEVQALDYQFSDEALPIQGGTSDAPRSTWPAMSDSVFYPGLYSGTGFDILAILLRVVNRPNPQFEIGAVDCSVALVLCDLEQPDQPIVYASDAFCDLTGYSQAEVLGHNCRFLQKPHPSAKGKSKSKPRHDKAAASQMRHALQRGAEIQLTVLNYRKDGHRFNNLISIIPVELDESGYRYAVGLLVEVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.15
3 0.14
4 0.14
5 0.14
6 0.15
7 0.14
8 0.15
9 0.15
10 0.1
11 0.09
12 0.09
13 0.09
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.1
20 0.1
21 0.1
22 0.11
23 0.12
24 0.17
25 0.18
26 0.19
27 0.18
28 0.19
29 0.21
30 0.21
31 0.22
32 0.18
33 0.2
34 0.18
35 0.16
36 0.14
37 0.12
38 0.12
39 0.1
40 0.1
41 0.07
42 0.07
43 0.08
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.05
50 0.04
51 0.04
52 0.05
53 0.06
54 0.07
55 0.12
56 0.16
57 0.18
58 0.21
59 0.23
60 0.24
61 0.23
62 0.22
63 0.24
64 0.2
65 0.19
66 0.16
67 0.13
68 0.11
69 0.11
70 0.1
71 0.04
72 0.04
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.05
79 0.05
80 0.07
81 0.07
82 0.06
83 0.06
84 0.07
85 0.07
86 0.06
87 0.07
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.07
103 0.08
104 0.12
105 0.11
106 0.12
107 0.12
108 0.14
109 0.15
110 0.17
111 0.25
112 0.28
113 0.36
114 0.42
115 0.51
116 0.53
117 0.57
118 0.65
119 0.66
120 0.66
121 0.67
122 0.7
123 0.72
124 0.79
125 0.85
126 0.8
127 0.8
128 0.78
129 0.76
130 0.73
131 0.73
132 0.67
133 0.58
134 0.56
135 0.49
136 0.47
137 0.41
138 0.35
139 0.26
140 0.22
141 0.23
142 0.22
143 0.2
144 0.17
145 0.16
146 0.15
147 0.15
148 0.16
149 0.13
150 0.16
151 0.14
152 0.15
153 0.17
154 0.22
155 0.26
156 0.32
157 0.36
158 0.43
159 0.45
160 0.46
161 0.52
162 0.47
163 0.42
164 0.36
165 0.31
166 0.21
167 0.19
168 0.17
169 0.09
170 0.09
171 0.09
172 0.09
173 0.1
174 0.11
175 0.11
176 0.11
177 0.1
178 0.1
179 0.1
180 0.1