Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179FH56

Protein Details
Accession A0A179FH56    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
118-143HAIAQCRYQRNRRPRLPKRRVVAPCSHydrophilic
NLS Segment(s)
PositionSequence
130-135RPRLPK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MPLSSRLSRTQINSPITTPSGQTATHKYRLHQSQPSKISMPSNIQSISFNITTSTPTKPKLQRQSDQPHNAVPHAPRAPSHLQINHPNSVRTPQNIHNPLPSTTITHPPPPTGPHILHAIAQCRYQRNRRPRLPKRRVVAPCSVWAAIALRPAKHDERTYEAGSEAETWLPVPDAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.42
4 0.38
5 0.3
6 0.25
7 0.22
8 0.21
9 0.23
10 0.28
11 0.32
12 0.4
13 0.4
14 0.39
15 0.46
16 0.54
17 0.58
18 0.58
19 0.59
20 0.6
21 0.63
22 0.65
23 0.57
24 0.51
25 0.47
26 0.41
27 0.4
28 0.32
29 0.31
30 0.27
31 0.26
32 0.25
33 0.23
34 0.23
35 0.17
36 0.15
37 0.13
38 0.13
39 0.15
40 0.16
41 0.19
42 0.18
43 0.2
44 0.29
45 0.35
46 0.44
47 0.52
48 0.58
49 0.58
50 0.65
51 0.73
52 0.75
53 0.74
54 0.66
55 0.59
56 0.52
57 0.47
58 0.41
59 0.32
60 0.29
61 0.24
62 0.23
63 0.19
64 0.24
65 0.26
66 0.26
67 0.29
68 0.25
69 0.27
70 0.35
71 0.38
72 0.37
73 0.35
74 0.32
75 0.29
76 0.3
77 0.27
78 0.21
79 0.22
80 0.22
81 0.31
82 0.35
83 0.35
84 0.35
85 0.35
86 0.34
87 0.33
88 0.28
89 0.22
90 0.2
91 0.26
92 0.24
93 0.27
94 0.27
95 0.26
96 0.27
97 0.26
98 0.28
99 0.26
100 0.25
101 0.22
102 0.24
103 0.24
104 0.25
105 0.24
106 0.24
107 0.2
108 0.23
109 0.24
110 0.28
111 0.34
112 0.4
113 0.48
114 0.55
115 0.64
116 0.71
117 0.79
118 0.84
119 0.89
120 0.9
121 0.89
122 0.84
123 0.84
124 0.81
125 0.76
126 0.73
127 0.65
128 0.59
129 0.55
130 0.48
131 0.38
132 0.31
133 0.27
134 0.2
135 0.22
136 0.21
137 0.17
138 0.19
139 0.25
140 0.29
141 0.32
142 0.35
143 0.33
144 0.38
145 0.43
146 0.43
147 0.38
148 0.35
149 0.3
150 0.27
151 0.24
152 0.18
153 0.13
154 0.11
155 0.1
156 0.1