Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DP13

Protein Details
Accession J9DP13   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
95-128LIDRKKLSNKKNEDLRKRNNKISKKPDNIKETKEHydrophilic
NLS Segment(s)
PositionSequence
98-121RKKLSNKKNEDLRKRNNKISKKPD
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MIRKDNANKQNIGGGCASESESDFSFVLKPPLVSMVIEGQSNKNNKLINNKNSNNINNNNIYNINKVKNSKVKPDNHDKLKSVLREKQFIFNKNLIDRKKLSNKKNEDLRKRNNKISKKPDNIKETKELPKITNKINNEDKETKNIEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.19
3 0.19
4 0.18
5 0.12
6 0.13
7 0.12
8 0.12
9 0.13
10 0.13
11 0.13
12 0.13
13 0.13
14 0.15
15 0.14
16 0.14
17 0.12
18 0.14
19 0.14
20 0.13
21 0.13
22 0.14
23 0.14
24 0.15
25 0.15
26 0.16
27 0.2
28 0.23
29 0.23
30 0.22
31 0.23
32 0.25
33 0.34
34 0.42
35 0.45
36 0.53
37 0.53
38 0.56
39 0.6
40 0.61
41 0.57
42 0.51
43 0.46
44 0.39
45 0.37
46 0.33
47 0.29
48 0.26
49 0.24
50 0.24
51 0.22
52 0.22
53 0.24
54 0.28
55 0.34
56 0.35
57 0.41
58 0.46
59 0.5
60 0.53
61 0.62
62 0.64
63 0.63
64 0.64
65 0.56
66 0.52
67 0.5
68 0.49
69 0.44
70 0.42
71 0.38
72 0.39
73 0.39
74 0.44
75 0.45
76 0.44
77 0.44
78 0.41
79 0.41
80 0.41
81 0.47
82 0.39
83 0.39
84 0.38
85 0.41
86 0.49
87 0.54
88 0.56
89 0.6
90 0.66
91 0.69
92 0.77
93 0.78
94 0.79
95 0.8
96 0.83
97 0.84
98 0.83
99 0.84
100 0.84
101 0.84
102 0.84
103 0.84
104 0.84
105 0.83
106 0.86
107 0.86
108 0.86
109 0.82
110 0.76
111 0.73
112 0.69
113 0.67
114 0.65
115 0.59
116 0.53
117 0.57
118 0.57
119 0.57
120 0.59
121 0.54
122 0.56
123 0.62
124 0.62
125 0.61
126 0.64
127 0.59
128 0.58