FuNGI

A0A179FIA3

Protein Details

Accession

A0A179FIA3

Localization Confidence

Medium

Confidence Score

13.2

NoLS Segment(s)

Position	Sequence	Protein Nature
402-436	TSGSSGSARKRNRLQKRRPGTKRKRNRYLIYIFPI	Hydrophilic

NLS Segment(s)

Position	Sequence
409-428	ARKRNRLQKRRPGTKRKRNR

Subcellular Location(s)

nucl 21, cyto_nucl 13, mito 3, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR007062 PPI-2
Gene Ontology	GO:0004864 F:protein phosphatase inhibitor activity GO:0043666 P:regulation of phosphoprotein phosphatase activity GO:0009966 P:regulation of signal transduction
Pfam	View protein in Pfam PF04979 IPP-2

Amino Acid Sequences

MASTVDRSPAHSPPGHDAKRPRGILKHSSSTSRSHTSPPPAAAPSTSPPKGRERSMSGKELTLANTQINAGHRRSSSSATRPPGSRRSSTHDPDGQAESSQRLKWDEANLYLTEQERTSTMKITEPKTPYAKHYDPAEDPSDDEDSLEGGSLRRKASGPGGEDDIPGLSLGDPEEEIAEADVPAHARQPSEKTVHVDDQDATPSAEEELVGISPEEREKHRQFEAARKKHYDMHNVAQLLGNPESIPDDEEDDQESKGAANVIVEEKEPAPGGLSPILSATARSLSWMSLPSLGSYVSFGAQPEEIQSPKPAETSPPLPTAPPSSPTFLRRLSLSSIPSVISLNRPPEEVEVSPKTSPPVPEPASPGLSFLSLPSLRSLASLSRQEEVEMQSPDIAIIPPSTSGSSGSARKRNRLQKRRPGTKRKRNRYLIYIFPIVIKRRRIMVDVGTQTDPLPPVDASPKRRSFLFGLGLRSA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.51
2	0.51
3	0.53
4	0.57
5	0.61
6	0.67
7	0.68
8	0.65
9	0.62
10	0.66
11	0.69
12	0.69
13	0.68
14	0.62
15	0.64
16	0.61
17	0.58
18	0.57
19	0.53
20	0.48
21	0.45
22	0.49
23	0.51
24	0.53
25	0.51
26	0.49
27	0.46
28	0.44
29	0.4
30	0.36
31	0.34
32	0.37
33	0.38
34	0.36
35	0.38
36	0.46
37	0.5
38	0.52
39	0.53
40	0.52
41	0.58
42	0.62
43	0.64
44	0.57
45	0.52
46	0.49
47	0.44
48	0.38
49	0.32
50	0.27
51	0.21
52	0.2
53	0.18
54	0.19
55	0.22
56	0.24
57	0.22
58	0.26
59	0.25
60	0.29
61	0.32
62	0.34
63	0.37
64	0.41
65	0.47
66	0.48
67	0.53
68	0.53
69	0.57
70	0.6
71	0.59
72	0.56
73	0.52
74	0.56
75	0.6
76	0.6
77	0.62
78	0.58
79	0.55
80	0.52
81	0.51
82	0.43
83	0.35
84	0.31
85	0.26
86	0.25
87	0.24
88	0.22
89	0.21
90	0.22
91	0.24
92	0.29
93	0.29
94	0.28
95	0.3
96	0.28
97	0.26
98	0.27
99	0.24
100	0.19
101	0.16
102	0.14
103	0.12
104	0.14
105	0.15
106	0.16
107	0.16
108	0.21
109	0.27
110	0.29
111	0.35
112	0.36
113	0.4
114	0.43
115	0.43
116	0.42
117	0.46
118	0.45
119	0.42
120	0.43
121	0.42
122	0.38
123	0.41
124	0.39
125	0.31
126	0.29
127	0.27
128	0.24
129	0.19
130	0.17
131	0.13
132	0.1
133	0.09
134	0.09
135	0.06
136	0.05
137	0.09
138	0.12
139	0.12
140	0.14
141	0.14
142	0.16
143	0.22
144	0.26
145	0.26
146	0.25
147	0.28
148	0.27
149	0.27
150	0.25
151	0.19
152	0.14
153	0.11
154	0.09
155	0.05
156	0.04
157	0.05
158	0.05
159	0.04
160	0.04
161	0.05
162	0.04
163	0.04
164	0.04
165	0.04
166	0.04
167	0.04
168	0.04
169	0.05
170	0.05
171	0.07
172	0.08
173	0.08
174	0.1
175	0.14
176	0.18
177	0.21
178	0.23
179	0.24
180	0.27
181	0.3
182	0.29
183	0.27
184	0.23
185	0.2
186	0.2
187	0.17
188	0.13
189	0.1
190	0.09
191	0.08
192	0.07
193	0.06
194	0.04
195	0.04
196	0.04
197	0.04
198	0.04
199	0.04
200	0.04
201	0.06
202	0.07
203	0.1
204	0.18
205	0.2
206	0.24
207	0.25
208	0.3
209	0.3
210	0.39
211	0.48
212	0.48
213	0.5
214	0.5
215	0.51
216	0.52
217	0.54
218	0.52
219	0.45
220	0.42
221	0.41
222	0.38
223	0.36
224	0.31
225	0.27
226	0.21
227	0.17
228	0.13
229	0.09
230	0.08
231	0.09
232	0.08
233	0.08
234	0.06
235	0.08
236	0.09
237	0.09
238	0.11
239	0.11
240	0.11
241	0.1
242	0.1
243	0.07
244	0.07
245	0.07
246	0.05
247	0.04
248	0.06
249	0.06
250	0.07
251	0.07
252	0.08
253	0.07
254	0.08
255	0.08
256	0.07
257	0.07
258	0.06
259	0.08
260	0.08
261	0.08
262	0.07
263	0.07
264	0.08
265	0.07
266	0.07
267	0.07
268	0.07
269	0.06
270	0.07
271	0.08
272	0.07
273	0.08
274	0.09
275	0.1
276	0.11
277	0.11
278	0.1
279	0.1
280	0.1
281	0.09
282	0.09
283	0.08
284	0.06
285	0.07
286	0.06
287	0.07
288	0.07
289	0.07
290	0.09
291	0.1
292	0.11
293	0.11
294	0.13
295	0.14
296	0.14
297	0.15
298	0.13
299	0.14
300	0.18
301	0.21
302	0.23
303	0.24
304	0.24
305	0.23
306	0.24
307	0.26
308	0.23
309	0.23
310	0.22
311	0.23
312	0.25
313	0.28
314	0.31
315	0.28
316	0.28
317	0.25
318	0.25
319	0.26
320	0.27
321	0.25
322	0.22
323	0.22
324	0.21
325	0.2
326	0.18
327	0.15
328	0.15
329	0.17
330	0.2
331	0.2
332	0.2
333	0.2
334	0.22
335	0.25
336	0.22
337	0.25
338	0.24
339	0.27
340	0.27
341	0.27
342	0.26
343	0.25
344	0.26
345	0.23
346	0.28
347	0.28
348	0.31
349	0.35
350	0.36
351	0.37
352	0.35
353	0.32
354	0.24
355	0.21
356	0.18
357	0.14
358	0.17
359	0.14
360	0.15
361	0.15
362	0.15
363	0.14
364	0.15
365	0.16
366	0.12
367	0.18
368	0.23
369	0.24
370	0.25
371	0.25
372	0.25
373	0.27
374	0.28
375	0.27
376	0.23
377	0.21
378	0.2
379	0.2
380	0.19
381	0.17
382	0.13
383	0.08
384	0.08
385	0.08
386	0.08
387	0.1
388	0.1
389	0.1
390	0.11
391	0.13
392	0.17
393	0.24
394	0.31
395	0.38
396	0.42
397	0.5
398	0.59
399	0.66
400	0.73
401	0.77
402	0.81
403	0.83
404	0.9
405	0.93
406	0.94
407	0.95
408	0.95
409	0.95
410	0.96
411	0.96
412	0.95
413	0.94
414	0.91
415	0.89
416	0.85
417	0.83
418	0.78
419	0.7
420	0.6
421	0.54
422	0.52
423	0.49
424	0.49
425	0.45
426	0.41
427	0.44
428	0.46
429	0.45
430	0.43
431	0.43
432	0.46
433	0.46
434	0.48
435	0.42
436	0.4
437	0.37
438	0.35
439	0.3
440	0.21
441	0.18
442	0.14
443	0.16
444	0.25
445	0.33
446	0.38
447	0.47
448	0.53
449	0.52
450	0.54
451	0.56
452	0.51
453	0.51
454	0.52
455	0.47

A0A179FIA3

3D AlphaFold-predicted Structure Viewer