Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A219ATP2

Protein Details
Accession A0A219ATP2   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-52NGVQNTSEHHQKRRRRQSEPSRYELLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, nucl 2, mito 1, cyto 1, golg 1, vacu 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR017946  PLC-like_Pdiesterase_TIM-brl  
Gene Ontology GO:0016020  C:membrane  
GO:0008081  F:phosphoric diester hydrolase activity  
GO:0006629  P:lipid metabolic process  
PROSITE View protein in PROSITE  
PS50007  PIPLC_X_DOMAIN  
Amino Acid Sequences MIEVTKHIEDTRTSTPSADDEKLSKDNGVQNTSEHHQKRRRRQSEPSRYELLCARSLLLWLIASGGTGLTVGIILVITWVAQPKAMRSTQSHNFISISPPNASSSTADAYLNSYSNSVIPVPVHSHNDYWRPYPLYSALAAGCTSVEADVWLSPDTSDLYVGHHRSALVPGRTLQSLYLNPLKEILDKLNPTNISDLANNPNGVFQTAPDTTLILLIDIKGNASQIWPIVNKQLEPLRQKGYLSTLEYNSSTSNATLTPTFQRRPITVVASGNIGKSNITGVGCEALAIYKETFLDAPIDALVEKSNFGILPGCQVDSFLGQPLAKFYTASAPFMRSFKMLNSGLTNGQKSTIRASLQAAAAKNLTSRYWSLPSWPISRRDYIWQFLVDEGIGLLNADDIESATRLEWNKAYKAELIWIGISSAYIFVASLVFAYLYDRSNTSKSSKKALAESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.32
4 0.36
5 0.32
6 0.28
7 0.28
8 0.32
9 0.35
10 0.34
11 0.3
12 0.29
13 0.34
14 0.37
15 0.38
16 0.33
17 0.31
18 0.35
19 0.39
20 0.43
21 0.41
22 0.45
23 0.51
24 0.61
25 0.71
26 0.77
27 0.82
28 0.8
29 0.86
30 0.88
31 0.9
32 0.87
33 0.83
34 0.78
35 0.69
36 0.64
37 0.58
38 0.51
39 0.43
40 0.36
41 0.3
42 0.24
43 0.24
44 0.22
45 0.17
46 0.13
47 0.09
48 0.09
49 0.08
50 0.07
51 0.07
52 0.06
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.06
67 0.06
68 0.09
69 0.09
70 0.12
71 0.19
72 0.2
73 0.23
74 0.26
75 0.33
76 0.39
77 0.47
78 0.45
79 0.4
80 0.39
81 0.36
82 0.38
83 0.34
84 0.29
85 0.23
86 0.23
87 0.23
88 0.23
89 0.23
90 0.19
91 0.18
92 0.17
93 0.17
94 0.16
95 0.14
96 0.15
97 0.16
98 0.15
99 0.12
100 0.11
101 0.1
102 0.1
103 0.11
104 0.09
105 0.09
106 0.09
107 0.1
108 0.14
109 0.17
110 0.21
111 0.21
112 0.24
113 0.26
114 0.33
115 0.33
116 0.31
117 0.33
118 0.31
119 0.3
120 0.3
121 0.28
122 0.23
123 0.21
124 0.21
125 0.17
126 0.14
127 0.14
128 0.11
129 0.09
130 0.07
131 0.06
132 0.04
133 0.04
134 0.04
135 0.04
136 0.05
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.08
143 0.08
144 0.08
145 0.07
146 0.1
147 0.15
148 0.16
149 0.16
150 0.15
151 0.15
152 0.15
153 0.2
154 0.22
155 0.18
156 0.18
157 0.19
158 0.21
159 0.21
160 0.2
161 0.17
162 0.14
163 0.14
164 0.17
165 0.2
166 0.18
167 0.18
168 0.2
169 0.19
170 0.17
171 0.18
172 0.17
173 0.17
174 0.18
175 0.18
176 0.22
177 0.21
178 0.21
179 0.21
180 0.19
181 0.16
182 0.15
183 0.17
184 0.16
185 0.17
186 0.16
187 0.15
188 0.15
189 0.13
190 0.13
191 0.1
192 0.07
193 0.1
194 0.1
195 0.1
196 0.1
197 0.1
198 0.09
199 0.1
200 0.1
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.07
214 0.07
215 0.08
216 0.12
217 0.12
218 0.12
219 0.14
220 0.18
221 0.22
222 0.24
223 0.27
224 0.27
225 0.27
226 0.27
227 0.26
228 0.25
229 0.23
230 0.23
231 0.22
232 0.19
233 0.2
234 0.2
235 0.2
236 0.16
237 0.14
238 0.11
239 0.09
240 0.08
241 0.07
242 0.08
243 0.08
244 0.09
245 0.14
246 0.18
247 0.19
248 0.22
249 0.24
250 0.23
251 0.26
252 0.27
253 0.25
254 0.23
255 0.23
256 0.2
257 0.21
258 0.21
259 0.18
260 0.15
261 0.13
262 0.09
263 0.08
264 0.08
265 0.08
266 0.07
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.06
273 0.05
274 0.05
275 0.06
276 0.06
277 0.06
278 0.06
279 0.07
280 0.07
281 0.07
282 0.08
283 0.07
284 0.07
285 0.06
286 0.07
287 0.06
288 0.06
289 0.07
290 0.06
291 0.06
292 0.06
293 0.06
294 0.06
295 0.06
296 0.08
297 0.07
298 0.11
299 0.11
300 0.12
301 0.11
302 0.11
303 0.12
304 0.11
305 0.12
306 0.09
307 0.1
308 0.1
309 0.1
310 0.12
311 0.13
312 0.12
313 0.12
314 0.11
315 0.18
316 0.19
317 0.22
318 0.21
319 0.22
320 0.24
321 0.25
322 0.25
323 0.18
324 0.18
325 0.16
326 0.23
327 0.21
328 0.21
329 0.22
330 0.23
331 0.27
332 0.3
333 0.29
334 0.22
335 0.24
336 0.24
337 0.23
338 0.25
339 0.24
340 0.21
341 0.22
342 0.24
343 0.26
344 0.26
345 0.29
346 0.25
347 0.23
348 0.22
349 0.21
350 0.2
351 0.17
352 0.15
353 0.14
354 0.16
355 0.19
356 0.23
357 0.23
358 0.26
359 0.31
360 0.36
361 0.39
362 0.42
363 0.43
364 0.44
365 0.47
366 0.45
367 0.48
368 0.48
369 0.45
370 0.43
371 0.39
372 0.35
373 0.32
374 0.3
375 0.2
376 0.15
377 0.11
378 0.08
379 0.06
380 0.05
381 0.05
382 0.04
383 0.04
384 0.04
385 0.04
386 0.04
387 0.06
388 0.06
389 0.07
390 0.07
391 0.11
392 0.13
393 0.17
394 0.21
395 0.24
396 0.29
397 0.3
398 0.32
399 0.31
400 0.3
401 0.32
402 0.29
403 0.26
404 0.22
405 0.2
406 0.18
407 0.15
408 0.14
409 0.1
410 0.08
411 0.06
412 0.05
413 0.05
414 0.05
415 0.05
416 0.05
417 0.05
418 0.05
419 0.05
420 0.05
421 0.07
422 0.09
423 0.11
424 0.13
425 0.15
426 0.18
427 0.21
428 0.25
429 0.3
430 0.36
431 0.38
432 0.45
433 0.5
434 0.5