Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9D988

Protein Details
Accession J9D988    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MVQLKQKRKLVKKAIQKPKIKESTDHydrophilic
NLS Segment(s)
PositionSequence
7-19KRKLVKKAIQKPK
81-92KGKKKAYIRMKK
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00276  Ribosomal_L23  
Amino Acid Sequences MVQLKQKRKLVKKAIQKPKIKESTDIIKYGLNNENVARQIEENNTLVFICDLKANKPSIRKAFEKLYGSKVLKVNTLITPKGKKKAYIRMKKAGEAANVANKIGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.87
4 0.83
5 0.83
6 0.83
7 0.74
8 0.67
9 0.62
10 0.62
11 0.57
12 0.51
13 0.42
14 0.35
15 0.33
16 0.34
17 0.33
18 0.24
19 0.22
20 0.21
21 0.23
22 0.22
23 0.22
24 0.18
25 0.13
26 0.14
27 0.15
28 0.17
29 0.15
30 0.13
31 0.13
32 0.11
33 0.11
34 0.09
35 0.07
36 0.05
37 0.07
38 0.07
39 0.08
40 0.12
41 0.14
42 0.16
43 0.21
44 0.27
45 0.31
46 0.35
47 0.37
48 0.38
49 0.4
50 0.44
51 0.44
52 0.4
53 0.38
54 0.41
55 0.39
56 0.4
57 0.39
58 0.34
59 0.31
60 0.3
61 0.28
62 0.26
63 0.29
64 0.26
65 0.28
66 0.36
67 0.39
68 0.46
69 0.46
70 0.48
71 0.52
72 0.6
73 0.66
74 0.69
75 0.71
76 0.73
77 0.74
78 0.71
79 0.7
80 0.64
81 0.56
82 0.49
83 0.45
84 0.43
85 0.4
86 0.36