Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179FYT9

Protein Details
Accession A0A179FYT9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MADKSKSKSKPQAKASPKPASPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 10, E.R. 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007482  Tyr_Pase-like_PTPLA  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0016829  F:lyase activity  
GO:0006633  P:fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF04387  PTPLA  
Amino Acid Sequences MADKSKSKSKPQAKASPKPASPLKTTYLILYNFASAIAWTVVLGRTLLLLYLRGPSTVYTGVGEWTKWTQTMAIMEVLHSLLGIVRAPLVTTIMQVSSRLLLVWPIVNTWPFLALSPFYSSMLIAWSVTEVIRYSYFALSLAGALPALLTWVRYSTFYILYPMGITSECMLIYGATGPAGELGAFGPVVLYAILAIYVPGSYVLFTHMMKQRGKVMRSLKTKDDKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.85
4 0.76
5 0.74
6 0.71
7 0.66
8 0.61
9 0.55
10 0.5
11 0.44
12 0.43
13 0.39
14 0.37
15 0.33
16 0.3
17 0.27
18 0.23
19 0.18
20 0.18
21 0.15
22 0.09
23 0.09
24 0.07
25 0.06
26 0.05
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.09
39 0.09
40 0.09
41 0.1
42 0.1
43 0.13
44 0.13
45 0.13
46 0.11
47 0.11
48 0.12
49 0.12
50 0.12
51 0.11
52 0.11
53 0.12
54 0.11
55 0.11
56 0.1
57 0.11
58 0.12
59 0.11
60 0.12
61 0.11
62 0.11
63 0.11
64 0.1
65 0.08
66 0.07
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.07
103 0.08
104 0.09
105 0.09
106 0.09
107 0.08
108 0.08
109 0.08
110 0.07
111 0.05
112 0.05
113 0.04
114 0.05
115 0.04
116 0.05
117 0.04
118 0.06
119 0.06
120 0.07
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.07
127 0.07
128 0.06
129 0.05
130 0.04
131 0.04
132 0.03
133 0.03
134 0.04
135 0.03
136 0.03
137 0.04
138 0.05
139 0.06
140 0.07
141 0.09
142 0.1
143 0.12
144 0.12
145 0.14
146 0.13
147 0.13
148 0.12
149 0.11
150 0.09
151 0.08
152 0.08
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.06
159 0.06
160 0.07
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.04
187 0.04
188 0.04
189 0.05
190 0.07
191 0.1
192 0.1
193 0.18
194 0.23
195 0.29
196 0.31
197 0.34
198 0.41
199 0.47
200 0.48
201 0.49
202 0.52
203 0.55
204 0.63
205 0.66
206 0.66
207 0.68