Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8ZW98

Protein Details
Accession J8ZW98    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
137-166KYEAYIRKKEYLKRLQKNNKSKLKNNKLRNHydrophilic
NLS Segment(s)
PositionSequence
145-165KEYLKRLQKNNKSKLKNNKLR
Subcellular Location(s) nucl 15, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MKKDFVRFLSQSLIFYEFVMGNDSTRTSTLQVRHMALQNNDSNLGNLTIEQNLPMDQVEITRTLITAYVYKTLSDEYSLLSLSNSSILFDSVYVDIFLFDNIISDNSANFIKNVIVKNSDVENLNISPEVINIMFKKYEAYIRKKEYLKRLQKNNKSKLKNNKLRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.22
4 0.16
5 0.15
6 0.17
7 0.15
8 0.12
9 0.13
10 0.13
11 0.12
12 0.13
13 0.14
14 0.13
15 0.18
16 0.21
17 0.26
18 0.3
19 0.31
20 0.34
21 0.37
22 0.4
23 0.36
24 0.39
25 0.35
26 0.32
27 0.32
28 0.28
29 0.24
30 0.19
31 0.18
32 0.12
33 0.1
34 0.1
35 0.09
36 0.09
37 0.09
38 0.08
39 0.08
40 0.08
41 0.07
42 0.07
43 0.06
44 0.06
45 0.07
46 0.07
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.09
54 0.09
55 0.11
56 0.11
57 0.11
58 0.12
59 0.12
60 0.11
61 0.1
62 0.1
63 0.07
64 0.07
65 0.07
66 0.07
67 0.06
68 0.06
69 0.05
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.06
76 0.05
77 0.07
78 0.05
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.05
92 0.05
93 0.06
94 0.07
95 0.07
96 0.07
97 0.07
98 0.08
99 0.12
100 0.14
101 0.15
102 0.16
103 0.17
104 0.19
105 0.19
106 0.2
107 0.18
108 0.16
109 0.17
110 0.15
111 0.16
112 0.14
113 0.13
114 0.1
115 0.09
116 0.1
117 0.08
118 0.1
119 0.1
120 0.13
121 0.13
122 0.13
123 0.14
124 0.14
125 0.22
126 0.28
127 0.36
128 0.42
129 0.49
130 0.57
131 0.62
132 0.68
133 0.7
134 0.73
135 0.76
136 0.76
137 0.81
138 0.84
139 0.88
140 0.91
141 0.91
142 0.91
143 0.89
144 0.89
145 0.89
146 0.89