FuNGI

A0A179FIH1

Protein Details

Accession

A0A179FIH1

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
423-442	SVGKVRQRQKCTSLTRRPFS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

extr 23, mito 2, cyto 1.5, cyto_nucl 1.5

Family & Domain DBs

InterPro	View protein in InterPro IPR029058 AB_hydrolase IPR022742 Hydrolase_4 IPR005152 Lipase_secreted
Gene Ontology	GO:0004177 F:aminopeptidase activity GO:0004806 F:triglyceride lipase activity GO:0016042 P:lipid catabolic process
Pfam	View protein in Pfam PF12146 Hydrolase_4

Amino Acid Sequences

MKVFYISVLLALGASARQNSNFNVTPEYAESHDCGSKCQQILDLTNRADLDSVGHDFSFDFFATAANFSTATQPGDVLKVEALNVSNLDVDSGTTVYRIQYASRDLDGETVPATGFIAFPYTPHFAGGSAGNGTRYKLAAYAHGTIGLFEGCAPSNSPNLYDYNTWKAAVQRGYAVVATDYAGLGNNFTSHKYLTLPAQVHDVYYSVVAARKIFGEALTGEWVSFGHSQGGGTVWKLAESEYVRNDARYLGTVALAPATYIIDMLMGKYGEVDFSGYLSFLPIAAERALPGYNASFLSDVMRKRIELATKAQLCIAGMLALPADLNKTQIVSPDGLAKDKDRLHEWQRMLSPAQGDRSSAPVLVVQGLNDTSVLPNTTVQAWDAACGFGNEVHLRLYPGQEHSPLMEASAPEWLGWLDELFGSVGKVRQRQKCTSLTRRPFSNTFVKQPAEGGRDFLKALKSILRE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.07
2	0.09
3	0.11
4	0.13
5	0.16
6	0.18
7	0.25
8	0.28
9	0.29
10	0.31
11	0.31
12	0.31
13	0.3
14	0.31
15	0.26
16	0.24
17	0.23
18	0.22
19	0.25
20	0.23
21	0.25
22	0.27
23	0.32
24	0.31
25	0.31
26	0.32
27	0.32
28	0.39
29	0.42
30	0.44
31	0.38
32	0.4
33	0.39
34	0.34
35	0.3
36	0.23
37	0.19
38	0.15
39	0.16
40	0.14
41	0.14
42	0.14
43	0.14
44	0.15
45	0.15
46	0.11
47	0.1
48	0.08
49	0.09
50	0.1
51	0.11
52	0.1
53	0.09
54	0.09
55	0.09
56	0.13
57	0.14
58	0.14
59	0.13
60	0.13
61	0.13
62	0.15
63	0.15
64	0.12
65	0.11
66	0.1
67	0.11
68	0.11
69	0.11
70	0.1
71	0.1
72	0.1
73	0.1
74	0.09
75	0.09
76	0.08
77	0.07
78	0.07
79	0.07
80	0.07
81	0.06
82	0.07
83	0.07
84	0.09
85	0.1
86	0.1
87	0.13
88	0.17
89	0.19
90	0.19
91	0.2
92	0.18
93	0.2
94	0.19
95	0.16
96	0.13
97	0.1
98	0.09
99	0.08
100	0.08
101	0.06
102	0.06
103	0.05
104	0.07
105	0.07
106	0.07
107	0.12
108	0.14
109	0.14
110	0.14
111	0.15
112	0.12
113	0.14
114	0.14
115	0.11
116	0.1
117	0.1
118	0.12
119	0.12
120	0.13
121	0.12
122	0.12
123	0.11
124	0.11
125	0.12
126	0.14
127	0.18
128	0.19
129	0.18
130	0.2
131	0.19
132	0.17
133	0.17
134	0.12
135	0.08
136	0.06
137	0.07
138	0.06
139	0.06
140	0.07
141	0.08
142	0.11
143	0.11
144	0.12
145	0.13
146	0.14
147	0.16
148	0.17
149	0.19
150	0.22
151	0.23
152	0.22
153	0.22
154	0.23
155	0.26
156	0.25
157	0.22
158	0.18
159	0.18
160	0.18
161	0.17
162	0.15
163	0.1
164	0.08
165	0.07
166	0.06
167	0.05
168	0.05
169	0.05
170	0.05
171	0.05
172	0.05
173	0.06
174	0.06
175	0.07
176	0.08
177	0.08
178	0.09
179	0.1
180	0.11
181	0.12
182	0.17
183	0.17
184	0.17
185	0.2
186	0.19
187	0.18
188	0.17
189	0.15
190	0.09
191	0.08
192	0.08
193	0.05
194	0.07
195	0.07
196	0.07
197	0.07
198	0.07
199	0.08
200	0.08
201	0.07
202	0.07
203	0.06
204	0.07
205	0.08
206	0.08
207	0.07
208	0.07
209	0.07
210	0.08
211	0.08
212	0.07
213	0.07
214	0.07
215	0.07
216	0.07
217	0.08
218	0.06
219	0.06
220	0.07
221	0.06
222	0.06
223	0.06
224	0.06
225	0.09
226	0.1
227	0.12
228	0.12
229	0.16
230	0.16
231	0.16
232	0.16
233	0.13
234	0.12
235	0.11
236	0.11
237	0.08
238	0.08
239	0.08
240	0.08
241	0.07
242	0.06
243	0.05
244	0.04
245	0.04
246	0.03
247	0.03
248	0.03
249	0.04
250	0.04
251	0.04
252	0.05
253	0.05
254	0.05
255	0.05
256	0.05
257	0.04
258	0.05
259	0.05
260	0.04
261	0.05
262	0.05
263	0.05
264	0.04
265	0.05
266	0.05
267	0.04
268	0.05
269	0.04
270	0.06
271	0.06
272	0.06
273	0.06
274	0.08
275	0.08
276	0.07
277	0.08
278	0.07
279	0.07
280	0.08
281	0.08
282	0.07
283	0.07
284	0.1
285	0.14
286	0.14
287	0.16
288	0.17
289	0.16
290	0.18
291	0.22
292	0.23
293	0.22
294	0.26
295	0.32
296	0.33
297	0.33
298	0.31
299	0.28
300	0.24
301	0.21
302	0.16
303	0.08
304	0.06
305	0.05
306	0.05
307	0.04
308	0.04
309	0.04
310	0.06
311	0.05
312	0.06
313	0.07
314	0.08
315	0.08
316	0.11
317	0.13
318	0.12
319	0.13
320	0.18
321	0.18
322	0.19
323	0.2
324	0.19
325	0.23
326	0.25
327	0.27
328	0.24
329	0.31
330	0.35
331	0.42
332	0.42
333	0.42
334	0.42
335	0.42
336	0.4
337	0.35
338	0.33
339	0.28
340	0.31
341	0.25
342	0.24
343	0.22
344	0.24
345	0.23
346	0.19
347	0.17
348	0.13
349	0.13
350	0.14
351	0.14
352	0.1
353	0.1
354	0.1
355	0.1
356	0.09
357	0.09
358	0.07
359	0.08
360	0.09
361	0.08
362	0.09
363	0.1
364	0.11
365	0.11
366	0.11
367	0.12
368	0.12
369	0.12
370	0.12
371	0.11
372	0.1
373	0.1
374	0.1
375	0.08
376	0.12
377	0.12
378	0.12
379	0.13
380	0.13
381	0.16
382	0.16
383	0.18
384	0.18
385	0.22
386	0.24
387	0.24
388	0.25
389	0.23
390	0.25
391	0.22
392	0.2
393	0.17
394	0.14
395	0.13
396	0.16
397	0.15
398	0.11
399	0.12
400	0.11
401	0.1
402	0.1
403	0.09
404	0.06
405	0.06
406	0.07
407	0.07
408	0.07
409	0.07
410	0.08
411	0.12
412	0.17
413	0.25
414	0.33
415	0.42
416	0.49
417	0.56
418	0.62
419	0.68
420	0.73
421	0.77
422	0.79
423	0.81
424	0.79
425	0.78
426	0.78
427	0.72
428	0.68
429	0.67
430	0.62
431	0.6
432	0.61
433	0.56
434	0.49
435	0.5
436	0.51
437	0.46
438	0.4
439	0.35
440	0.32
441	0.32
442	0.32
443	0.31
444	0.27
445	0.23
446	0.25

A0A179FIH1

3D AlphaFold-predicted Structure Viewer