Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179FDP4

Protein Details
Accession A0A179FDP4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
30-56LARRQRRLLSRMRRRQRRLRWDLPEIPHydrophilic
NLS Segment(s)
PositionSequence
32-47RRQRRLLSRMRRRQRR
Subcellular Location(s) mito 9cyto 9cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MSLWEKVRDKTAVEAWAWAVSANSVVDSGLARRQRRLLSRMRRRQRRLRWDLPEIPGVAWMVVDGCENGRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.22
4 0.2
5 0.15
6 0.11
7 0.07
8 0.07
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.1
17 0.16
18 0.16
19 0.18
20 0.22
21 0.26
22 0.3
23 0.34
24 0.39
25 0.45
26 0.56
27 0.65
28 0.72
29 0.78
30 0.82
31 0.87
32 0.88
33 0.88
34 0.87
35 0.86
36 0.83
37 0.81
38 0.79
39 0.72
40 0.65
41 0.54
42 0.44
43 0.36
44 0.29
45 0.2
46 0.14
47 0.1
48 0.07
49 0.06
50 0.07
51 0.06