Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DN75

Protein Details
Accession J9DN75    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-51SSQLNNLKQMKKNKKNDANLENNRNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013272  Vps72/YL1_C  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MIKENLCAFFGCYRAFLNLKIKFLRMSSQLNNLKQMKKNKKNDANLENNRNSNRRVLKYNLKQINTENNEHVENAINVDFQSYKAFCDITGLPAHYKCSKTGILCHDLAVFEFVKEMKIEDAKRYVKMRNLCRRHTFLEDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.24
4 0.31
5 0.32
6 0.36
7 0.37
8 0.37
9 0.34
10 0.34
11 0.35
12 0.3
13 0.33
14 0.31
15 0.39
16 0.45
17 0.45
18 0.52
19 0.53
20 0.54
21 0.54
22 0.62
23 0.63
24 0.66
25 0.74
26 0.77
27 0.81
28 0.83
29 0.85
30 0.83
31 0.83
32 0.81
33 0.79
34 0.72
35 0.67
36 0.62
37 0.55
38 0.48
39 0.45
40 0.43
41 0.38
42 0.39
43 0.41
44 0.47
45 0.52
46 0.61
47 0.59
48 0.54
49 0.52
50 0.49
51 0.53
52 0.47
53 0.41
54 0.33
55 0.28
56 0.27
57 0.25
58 0.23
59 0.14
60 0.1
61 0.09
62 0.08
63 0.07
64 0.06
65 0.07
66 0.07
67 0.06
68 0.09
69 0.08
70 0.08
71 0.09
72 0.09
73 0.08
74 0.11
75 0.11
76 0.11
77 0.13
78 0.14
79 0.15
80 0.15
81 0.19
82 0.2
83 0.2
84 0.19
85 0.21
86 0.23
87 0.23
88 0.29
89 0.32
90 0.32
91 0.32
92 0.32
93 0.28
94 0.25
95 0.24
96 0.2
97 0.14
98 0.09
99 0.1
100 0.09
101 0.09
102 0.09
103 0.1
104 0.11
105 0.17
106 0.19
107 0.23
108 0.31
109 0.33
110 0.39
111 0.42
112 0.44
113 0.46
114 0.53
115 0.59
116 0.62
117 0.67
118 0.7
119 0.75
120 0.76
121 0.74