Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179FZG9

Protein Details
Accession A0A179FZG9    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
162-196TSIRGDGRRERKERIKRNERKMRKNEKDAMNARRSBasic
NLS Segment(s)
PositionSequence
88-118EKPVPEAKPKTKWERFAEKKGIKAKTREQRR
153-195KKERERKEGTSIRGDGRRERKERIKRNERKMRKNEKDAMNARR
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MALPGSRPKLPISVDKPTPYTFDLGLLLAEDPNTITLDHSSLEQSLAEVARDGAQSLINQLLTTCPISSTKDGVLLSLPAPSTALPREKPVPEAKPKTKWERFAEKKGIKAKTREQRRNLAYDEESGEWKRKWGYKALNKKGEDDPIVEVDMKKERERKEGTSIRGDGRRERKERIKRNERKMRKNEKDAMNARRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.52
4 0.48
5 0.48
6 0.4
7 0.36
8 0.27
9 0.23
10 0.21
11 0.17
12 0.16
13 0.13
14 0.11
15 0.09
16 0.08
17 0.07
18 0.06
19 0.06
20 0.07
21 0.06
22 0.07
23 0.08
24 0.09
25 0.09
26 0.09
27 0.1
28 0.09
29 0.1
30 0.09
31 0.08
32 0.09
33 0.09
34 0.08
35 0.07
36 0.07
37 0.09
38 0.09
39 0.09
40 0.07
41 0.08
42 0.08
43 0.09
44 0.1
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.08
52 0.08
53 0.09
54 0.12
55 0.14
56 0.15
57 0.14
58 0.16
59 0.16
60 0.16
61 0.15
62 0.13
63 0.11
64 0.11
65 0.1
66 0.06
67 0.07
68 0.07
69 0.08
70 0.1
71 0.13
72 0.13
73 0.16
74 0.2
75 0.2
76 0.24
77 0.27
78 0.31
79 0.37
80 0.44
81 0.46
82 0.5
83 0.55
84 0.62
85 0.61
86 0.62
87 0.6
88 0.62
89 0.64
90 0.64
91 0.68
92 0.61
93 0.62
94 0.62
95 0.62
96 0.55
97 0.54
98 0.55
99 0.54
100 0.63
101 0.66
102 0.64
103 0.66
104 0.66
105 0.65
106 0.58
107 0.53
108 0.44
109 0.37
110 0.34
111 0.26
112 0.25
113 0.21
114 0.23
115 0.18
116 0.19
117 0.21
118 0.23
119 0.25
120 0.3
121 0.4
122 0.46
123 0.57
124 0.65
125 0.7
126 0.66
127 0.68
128 0.63
129 0.58
130 0.5
131 0.4
132 0.33
133 0.25
134 0.25
135 0.22
136 0.19
137 0.17
138 0.21
139 0.22
140 0.25
141 0.3
142 0.32
143 0.4
144 0.46
145 0.47
146 0.52
147 0.56
148 0.56
149 0.58
150 0.58
151 0.55
152 0.55
153 0.53
154 0.52
155 0.55
156 0.6
157 0.56
158 0.62
159 0.67
160 0.72
161 0.8
162 0.82
163 0.83
164 0.84
165 0.9
166 0.93
167 0.93
168 0.93
169 0.94
170 0.94
171 0.93
172 0.93
173 0.91
174 0.88
175 0.88
176 0.86