Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179EYN5

Protein Details
Accession A0A179EYN5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-37ADLSRIRDNQRKSRARRKEYFQELEQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MTSPAVSSNIPADLSRIRDNQRKSRARRKEYFQELEQRLRVYELQGIEASAEVQKSARKVFDKNKQLRELLNKHGVTDAYILQYLQRPTVSTPESSLDQMMQAGAGEVATQLQQQLMLPKQAAYLEKSILFEGPRQSNHSISVISTTHSPGWEPSQSTMAYSHHAQQLGVCPPERHHYSPSVFLTQPAPTQLNPFQSSCPGHMTSDSSHGLAKSEPMPGDSRPAVNNKSPMDPCKDLGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.31
4 0.37
5 0.44
6 0.52
7 0.59
8 0.66
9 0.71
10 0.75
11 0.8
12 0.84
13 0.86
14 0.87
15 0.86
16 0.86
17 0.86
18 0.83
19 0.78
20 0.77
21 0.72
22 0.7
23 0.63
24 0.54
25 0.44
26 0.4
27 0.35
28 0.26
29 0.25
30 0.19
31 0.18
32 0.18
33 0.17
34 0.14
35 0.13
36 0.12
37 0.09
38 0.08
39 0.06
40 0.07
41 0.09
42 0.12
43 0.14
44 0.19
45 0.2
46 0.28
47 0.37
48 0.46
49 0.55
50 0.61
51 0.67
52 0.67
53 0.66
54 0.64
55 0.64
56 0.6
57 0.56
58 0.56
59 0.48
60 0.43
61 0.43
62 0.38
63 0.29
64 0.25
65 0.19
66 0.11
67 0.12
68 0.11
69 0.1
70 0.14
71 0.13
72 0.13
73 0.12
74 0.12
75 0.12
76 0.18
77 0.18
78 0.15
79 0.16
80 0.17
81 0.18
82 0.17
83 0.17
84 0.12
85 0.1
86 0.1
87 0.08
88 0.06
89 0.04
90 0.04
91 0.03
92 0.03
93 0.03
94 0.02
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.04
101 0.04
102 0.07
103 0.08
104 0.09
105 0.09
106 0.09
107 0.1
108 0.11
109 0.12
110 0.11
111 0.11
112 0.11
113 0.12
114 0.13
115 0.12
116 0.12
117 0.11
118 0.11
119 0.14
120 0.16
121 0.17
122 0.2
123 0.22
124 0.22
125 0.23
126 0.22
127 0.18
128 0.15
129 0.17
130 0.13
131 0.12
132 0.12
133 0.12
134 0.11
135 0.11
136 0.11
137 0.1
138 0.13
139 0.15
140 0.15
141 0.15
142 0.17
143 0.17
144 0.18
145 0.18
146 0.15
147 0.16
148 0.16
149 0.19
150 0.19
151 0.19
152 0.18
153 0.17
154 0.22
155 0.24
156 0.24
157 0.22
158 0.19
159 0.21
160 0.28
161 0.32
162 0.3
163 0.29
164 0.33
165 0.34
166 0.41
167 0.42
168 0.4
169 0.34
170 0.33
171 0.32
172 0.27
173 0.26
174 0.23
175 0.21
176 0.17
177 0.22
178 0.25
179 0.29
180 0.3
181 0.3
182 0.28
183 0.32
184 0.34
185 0.31
186 0.32
187 0.27
188 0.25
189 0.26
190 0.27
191 0.23
192 0.27
193 0.26
194 0.22
195 0.22
196 0.21
197 0.2
198 0.18
199 0.19
200 0.15
201 0.18
202 0.18
203 0.19
204 0.21
205 0.21
206 0.27
207 0.26
208 0.27
209 0.27
210 0.34
211 0.36
212 0.39
213 0.46
214 0.42
215 0.48
216 0.5
217 0.51
218 0.52
219 0.51