Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DQH3

Protein Details
Accession J9DQH3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
130-157IFPEPDRRSARSKKKRSNNPDPDHLKKPBasic
NLS Segment(s)
PositionSequence
136-146RRSARSKKKRS
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR045128  PI31-like  
IPR013886  PI31_Prot_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0004866  F:endopeptidase inhibitor activity  
GO:0070628  F:proteasome binding  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF08577  PI31_Prot_C  
Amino Acid Sequences MKFEEFIKLIERNGFTYEKRDNRHLVSKKNIVKEINLSKDIDYDDFIKNFDLNATKSSVLTNNDRHDAKLYNIGHDDLLPSTKLQSDDFEPSGMLVGPNHPLFDPRNNNYDETHDEEFITPPPMAKFDPIFPEPDRRSARSKKKRSNNPDPDHLKKPGNNNGFFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.31
4 0.39
5 0.41
6 0.45
7 0.49
8 0.5
9 0.53
10 0.62
11 0.62
12 0.61
13 0.62
14 0.66
15 0.67
16 0.68
17 0.68
18 0.59
19 0.54
20 0.55
21 0.54
22 0.51
23 0.46
24 0.41
25 0.36
26 0.36
27 0.34
28 0.27
29 0.2
30 0.17
31 0.17
32 0.16
33 0.17
34 0.15
35 0.14
36 0.13
37 0.14
38 0.13
39 0.12
40 0.13
41 0.15
42 0.14
43 0.14
44 0.16
45 0.17
46 0.18
47 0.22
48 0.25
49 0.26
50 0.3
51 0.3
52 0.3
53 0.28
54 0.27
55 0.23
56 0.26
57 0.24
58 0.21
59 0.21
60 0.21
61 0.19
62 0.17
63 0.17
64 0.08
65 0.09
66 0.07
67 0.06
68 0.06
69 0.08
70 0.09
71 0.08
72 0.09
73 0.11
74 0.14
75 0.15
76 0.14
77 0.13
78 0.12
79 0.12
80 0.1
81 0.08
82 0.05
83 0.05
84 0.08
85 0.08
86 0.09
87 0.08
88 0.1
89 0.12
90 0.2
91 0.27
92 0.27
93 0.32
94 0.33
95 0.34
96 0.33
97 0.35
98 0.31
99 0.29
100 0.29
101 0.24
102 0.23
103 0.23
104 0.22
105 0.2
106 0.18
107 0.12
108 0.12
109 0.12
110 0.13
111 0.13
112 0.15
113 0.16
114 0.17
115 0.23
116 0.22
117 0.26
118 0.26
119 0.35
120 0.35
121 0.42
122 0.44
123 0.42
124 0.5
125 0.56
126 0.65
127 0.67
128 0.76
129 0.77
130 0.83
131 0.9
132 0.92
133 0.93
134 0.93
135 0.9
136 0.89
137 0.87
138 0.83
139 0.79
140 0.75
141 0.71
142 0.64
143 0.66
144 0.65
145 0.66