Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DJW4

Protein Details
Accession J9DJW4   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-40IFGEIFKIERRKRCFKNKPKMKNVQRAKPSQKKIFEIHydrophilic
NLS Segment(s)
PositionSequence
13-34RRKRCFKNKPKMKNVQRAKPSQ
Subcellular Location(s) cyto 16, cyto_nucl 12.5, nucl 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009091  RCC1/BLIP-II  
IPR000408  Reg_chr_condens  
Pfam View protein in Pfam  
PF00415  RCC1  
PF13540  RCC1_2  
PROSITE View protein in PROSITE  
PS00626  RCC1_2  
PS50012  RCC1_3  
Amino Acid Sequences MALIFGEIFKIERRKRCFKNKPKMKNVQRAKPSQKKIFEISGGDYHILGITYDGNVKAWGNNFCGQHGNGHKICFDSPTDIIKIKNIVKVKGGTTHSVFLDNDRNLYGCGENDYGQLSHKEKEILTPTLVANNVLDFTTAGLITFVVKEDGVYSCGTNYYGELGHKENGENVDFLNKINFNFGKVIRITCGGSHAIIVVDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.67
3 0.77
4 0.83
5 0.84
6 0.88
7 0.9
8 0.93
9 0.93
10 0.95
11 0.94
12 0.93
13 0.92
14 0.91
15 0.89
16 0.88
17 0.88
18 0.87
19 0.86
20 0.85
21 0.81
22 0.76
23 0.72
24 0.66
25 0.58
26 0.5
27 0.44
28 0.38
29 0.32
30 0.28
31 0.23
32 0.18
33 0.15
34 0.13
35 0.09
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.1
45 0.13
46 0.14
47 0.17
48 0.21
49 0.21
50 0.22
51 0.24
52 0.23
53 0.26
54 0.27
55 0.3
56 0.27
57 0.27
58 0.26
59 0.25
60 0.25
61 0.2
62 0.18
63 0.15
64 0.15
65 0.16
66 0.18
67 0.18
68 0.18
69 0.17
70 0.2
71 0.19
72 0.23
73 0.22
74 0.22
75 0.23
76 0.25
77 0.24
78 0.26
79 0.26
80 0.24
81 0.23
82 0.23
83 0.21
84 0.21
85 0.2
86 0.16
87 0.2
88 0.17
89 0.16
90 0.15
91 0.15
92 0.13
93 0.14
94 0.12
95 0.06
96 0.09
97 0.09
98 0.09
99 0.1
100 0.1
101 0.1
102 0.1
103 0.13
104 0.13
105 0.13
106 0.13
107 0.14
108 0.13
109 0.18
110 0.21
111 0.2
112 0.19
113 0.19
114 0.18
115 0.19
116 0.2
117 0.15
118 0.11
119 0.09
120 0.09
121 0.07
122 0.08
123 0.05
124 0.05
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.07
138 0.08
139 0.09
140 0.09
141 0.08
142 0.09
143 0.1
144 0.09
145 0.09
146 0.09
147 0.1
148 0.11
149 0.13
150 0.15
151 0.17
152 0.17
153 0.17
154 0.18
155 0.2
156 0.2
157 0.18
158 0.15
159 0.17
160 0.17
161 0.17
162 0.19
163 0.17
164 0.16
165 0.24
166 0.23
167 0.22
168 0.26
169 0.26
170 0.28
171 0.28
172 0.29
173 0.24
174 0.27
175 0.26
176 0.22
177 0.25
178 0.2
179 0.19
180 0.17
181 0.15
182 0.13