Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D416

Protein Details
Accession J9D416   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
143-167DKMSRNNRLANKHNHKKGNRSVDRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MNDFNNFHCTGNINNYRNPGYKNNLDNVSNINDMCNMNNNYENNMVYNSNINRYNDIYGIRKKRLSRSAENYKIASSIDKDYNNNFNFRTTRNNNIRCDRLENAYINRNNIDTIKNNNMNIGFVNNINNRSVGLDRSKDRFIDKMSRNNRLANKHNHKKGNRSVDRSNNVILKIKIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.47
4 0.48
5 0.5
6 0.46
7 0.44
8 0.48
9 0.49
10 0.51
11 0.51
12 0.48
13 0.44
14 0.41
15 0.38
16 0.32
17 0.27
18 0.21
19 0.2
20 0.19
21 0.19
22 0.23
23 0.2
24 0.21
25 0.25
26 0.25
27 0.25
28 0.27
29 0.26
30 0.2
31 0.2
32 0.18
33 0.14
34 0.19
35 0.17
36 0.2
37 0.24
38 0.24
39 0.24
40 0.26
41 0.26
42 0.22
43 0.24
44 0.25
45 0.29
46 0.34
47 0.36
48 0.39
49 0.41
50 0.47
51 0.53
52 0.55
53 0.55
54 0.58
55 0.65
56 0.68
57 0.67
58 0.6
59 0.51
60 0.45
61 0.36
62 0.28
63 0.19
64 0.15
65 0.16
66 0.17
67 0.18
68 0.2
69 0.28
70 0.28
71 0.27
72 0.24
73 0.23
74 0.23
75 0.23
76 0.3
77 0.25
78 0.34
79 0.42
80 0.48
81 0.5
82 0.53
83 0.55
84 0.48
85 0.49
86 0.41
87 0.35
88 0.32
89 0.29
90 0.27
91 0.32
92 0.31
93 0.28
94 0.27
95 0.24
96 0.22
97 0.21
98 0.21
99 0.16
100 0.2
101 0.26
102 0.29
103 0.29
104 0.3
105 0.29
106 0.26
107 0.24
108 0.2
109 0.13
110 0.1
111 0.16
112 0.16
113 0.17
114 0.17
115 0.17
116 0.16
117 0.17
118 0.18
119 0.16
120 0.18
121 0.22
122 0.25
123 0.29
124 0.31
125 0.31
126 0.32
127 0.32
128 0.32
129 0.38
130 0.4
131 0.46
132 0.52
133 0.59
134 0.59
135 0.63
136 0.65
137 0.63
138 0.65
139 0.66
140 0.7
141 0.72
142 0.79
143 0.81
144 0.8
145 0.82
146 0.83
147 0.83
148 0.81
149 0.79
150 0.79
151 0.8
152 0.79
153 0.72
154 0.68
155 0.61
156 0.54
157 0.53