Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DAV5

Protein Details
Accession J9DAV5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKRNRQKRNEKIINKLKFTCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, E.R. 5, plas 4, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKRNRQKRNEKIINKLKFTCLKFLFTMTFLLLIINFIRFILIMLFYFSPIIPASFPCWVSCSIFNKNDSIMEIEIPKTNFLFKQFVFIHLYQIFISRIATIIDIFPSKFIKYLYFYLNSCVCAESNRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.7
4 0.67
5 0.62
6 0.6
7 0.52
8 0.48
9 0.42
10 0.42
11 0.36
12 0.29
13 0.28
14 0.19
15 0.17
16 0.13
17 0.12
18 0.09
19 0.08
20 0.08
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.06
27 0.05
28 0.05
29 0.05
30 0.07
31 0.07
32 0.07
33 0.08
34 0.07
35 0.08
36 0.07
37 0.07
38 0.06
39 0.07
40 0.09
41 0.11
42 0.11
43 0.1
44 0.12
45 0.12
46 0.14
47 0.17
48 0.19
49 0.23
50 0.25
51 0.26
52 0.25
53 0.24
54 0.23
55 0.19
56 0.17
57 0.11
58 0.1
59 0.1
60 0.1
61 0.12
62 0.12
63 0.12
64 0.1
65 0.11
66 0.11
67 0.14
68 0.17
69 0.14
70 0.22
71 0.22
72 0.24
73 0.28
74 0.28
75 0.3
76 0.26
77 0.28
78 0.2
79 0.21
80 0.19
81 0.14
82 0.14
83 0.09
84 0.09
85 0.08
86 0.09
87 0.07
88 0.07
89 0.09
90 0.1
91 0.1
92 0.11
93 0.13
94 0.13
95 0.14
96 0.14
97 0.16
98 0.19
99 0.23
100 0.26
101 0.28
102 0.29
103 0.32
104 0.33
105 0.31
106 0.28
107 0.25
108 0.21