Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D1H8

Protein Details
Accession J9D1H8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-43SSNSSKKLNTKIKPIQKRKPEKCCQSCISTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences NLELEEKCSPLKISSNSSKKLNTKIKPIQKRKPEKCCQSCISTSKNSLLKKEKINVVRPKLTTGFAVNSQRFKKKNPVISPHSEMMHKTCNKSSNDDSNKFFSKMTSNSNLRISEGENSSEQKNYKLKNYYFIFCSGEECTKGNYIFYKQILRNNIFCDFNDVNKPEKYNEEKCAFNIENKQLYSENSSIAQFTKDENKITFLFTQKCFFYSNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.54
4 0.58
5 0.62
6 0.61
7 0.66
8 0.68
9 0.63
10 0.65
11 0.7
12 0.76
13 0.79
14 0.84
15 0.84
16 0.85
17 0.91
18 0.9
19 0.91
20 0.91
21 0.91
22 0.88
23 0.86
24 0.8
25 0.75
26 0.72
27 0.66
28 0.62
29 0.56
30 0.51
31 0.5
32 0.52
33 0.48
34 0.49
35 0.51
36 0.51
37 0.52
38 0.56
39 0.56
40 0.57
41 0.65
42 0.66
43 0.65
44 0.66
45 0.6
46 0.58
47 0.52
48 0.46
49 0.38
50 0.31
51 0.25
52 0.24
53 0.31
54 0.29
55 0.33
56 0.36
57 0.42
58 0.41
59 0.43
60 0.48
61 0.48
62 0.56
63 0.57
64 0.62
65 0.61
66 0.66
67 0.67
68 0.59
69 0.53
70 0.44
71 0.37
72 0.31
73 0.33
74 0.28
75 0.26
76 0.27
77 0.32
78 0.33
79 0.37
80 0.39
81 0.41
82 0.46
83 0.48
84 0.47
85 0.45
86 0.45
87 0.4
88 0.36
89 0.27
90 0.23
91 0.22
92 0.24
93 0.26
94 0.26
95 0.27
96 0.3
97 0.29
98 0.26
99 0.25
100 0.21
101 0.17
102 0.17
103 0.16
104 0.14
105 0.15
106 0.15
107 0.17
108 0.17
109 0.18
110 0.22
111 0.23
112 0.28
113 0.34
114 0.34
115 0.4
116 0.43
117 0.4
118 0.37
119 0.37
120 0.33
121 0.25
122 0.27
123 0.2
124 0.19
125 0.18
126 0.17
127 0.16
128 0.16
129 0.16
130 0.15
131 0.15
132 0.17
133 0.19
134 0.21
135 0.27
136 0.27
137 0.32
138 0.38
139 0.39
140 0.39
141 0.38
142 0.4
143 0.34
144 0.31
145 0.34
146 0.28
147 0.28
148 0.32
149 0.3
150 0.31
151 0.32
152 0.34
153 0.27
154 0.34
155 0.39
156 0.37
157 0.43
158 0.43
159 0.42
160 0.41
161 0.48
162 0.41
163 0.39
164 0.41
165 0.4
166 0.43
167 0.41
168 0.43
169 0.36
170 0.37
171 0.38
172 0.31
173 0.26
174 0.22
175 0.22
176 0.2
177 0.2
178 0.19
179 0.14
180 0.16
181 0.23
182 0.25
183 0.28
184 0.28
185 0.32
186 0.31
187 0.34
188 0.35
189 0.33
190 0.36
191 0.36
192 0.39
193 0.36
194 0.37