Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DQU8

Protein Details
Accession J9DQU8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SLLTVHRKKANKRVLDKSKRSRVWGNHydrophilic
NLS Segment(s)
PositionSequence
9-20KKANKRVLDKSK
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MSLLTVHRKKANKRVLDKSKRSRVWGNVDIYFVANNNKLRVLIRCFKSCIVSNNLYARTKSDDVAILIGRSESTEKLELFKLFYYILEDISIGAVTIYAENDSFNIDDSLKFVSWYEIIGQVGECWIDGPVKALFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.86
4 0.88
5 0.88
6 0.89
7 0.84
8 0.81
9 0.78
10 0.74
11 0.72
12 0.69
13 0.63
14 0.54
15 0.5
16 0.45
17 0.38
18 0.3
19 0.21
20 0.17
21 0.17
22 0.17
23 0.17
24 0.17
25 0.17
26 0.18
27 0.22
28 0.26
29 0.3
30 0.33
31 0.35
32 0.36
33 0.37
34 0.39
35 0.37
36 0.35
37 0.33
38 0.31
39 0.31
40 0.33
41 0.36
42 0.34
43 0.31
44 0.28
45 0.27
46 0.25
47 0.22
48 0.19
49 0.16
50 0.15
51 0.16
52 0.14
53 0.09
54 0.08
55 0.07
56 0.06
57 0.05
58 0.06
59 0.05
60 0.07
61 0.09
62 0.09
63 0.11
64 0.13
65 0.13
66 0.13
67 0.13
68 0.12
69 0.1
70 0.1
71 0.11
72 0.1
73 0.1
74 0.09
75 0.08
76 0.08
77 0.08
78 0.07
79 0.04
80 0.04
81 0.03
82 0.03
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.06
90 0.06
91 0.07
92 0.08
93 0.08
94 0.08
95 0.09
96 0.12
97 0.11
98 0.12
99 0.11
100 0.12
101 0.11
102 0.12
103 0.13
104 0.12
105 0.12
106 0.12
107 0.12
108 0.1
109 0.11
110 0.1
111 0.08
112 0.06
113 0.07
114 0.07
115 0.07
116 0.09
117 0.11