Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DRU0

Protein Details
Accession J9DRU0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-135KKAAPAKKPTPAKKAKPTKKAASAKKAKPTKKAAPAKKAKPSKKAKSSKKAGRKBasic
NLS Segment(s)
PositionSequence
41-135NGGALKKAESSKKGVAPKKPEIPKKATPVKKAAPAKKATPAKKAAPAKKPTPAKKAKPTKKAASAKKAKPTKKAAPAKKAKPSKKAKSSKKAGRK
Subcellular Location(s) mito 10, nucl 7, cyto 5, plas 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005819  H1/H5  
Gene Ontology GO:0000786  C:nucleosome  
GO:0003677  F:DNA binding  
GO:0030527  F:structural constituent of chromatin  
GO:0006334  P:nucleosome assembly  
Amino Acid Sequences MHNLINNLFTMIVLISGMIECGCPIQQKPVSCPAMPKPAPNGGALKKAESSKKGVAPKKPEIPKKATPVKKAAPAKKATPAKKAAPAKKPTPAKKAKPTKKAASAKKAKPTKKAAPAKKAKPSKKAKSSKKAGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.05
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.08
11 0.09
12 0.17
13 0.21
14 0.24
15 0.28
16 0.36
17 0.39
18 0.38
19 0.42
20 0.39
21 0.45
22 0.44
23 0.42
24 0.37
25 0.39
26 0.4
27 0.37
28 0.37
29 0.28
30 0.34
31 0.32
32 0.29
33 0.26
34 0.29
35 0.31
36 0.28
37 0.31
38 0.28
39 0.34
40 0.4
41 0.43
42 0.46
43 0.5
44 0.54
45 0.58
46 0.61
47 0.62
48 0.6
49 0.61
50 0.61
51 0.62
52 0.65
53 0.61
54 0.57
55 0.57
56 0.54
57 0.56
58 0.58
59 0.55
60 0.52
61 0.5
62 0.49
63 0.51
64 0.56
65 0.51
66 0.5
67 0.49
68 0.46
69 0.51
70 0.57
71 0.56
72 0.57
73 0.6
74 0.57
75 0.61
76 0.67
77 0.65
78 0.67
79 0.69
80 0.69
81 0.73
82 0.8
83 0.81
84 0.82
85 0.84
86 0.81
87 0.82
88 0.83
89 0.82
90 0.82
91 0.82
92 0.79
93 0.81
94 0.82
95 0.78
96 0.77
97 0.77
98 0.76
99 0.76
100 0.79
101 0.79
102 0.8
103 0.85
104 0.85
105 0.86
106 0.87
107 0.85
108 0.85
109 0.86
110 0.86
111 0.87
112 0.89
113 0.89
114 0.9
115 0.92