Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZLG0

Protein Details
Accession A0A178ZLG0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
100-126KKDASRVTEKQKKRQTHFPARKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
87-120RPKLTRAIRRRLSKKDASRVTEKQKKRQTHFPAR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTNAKVKPGQLWGKSKDDLKKQLDELKTELGQLRVQKIAGGASSKLTRIHDLRKSIARVLTVINANQRHQLRLFYAKKKYLPLDLRPKLTRAIRRRLSKKDASRVTEKQKKRQTHFPARKYAVKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.57
3 0.59
4 0.58
5 0.58
6 0.6
7 0.57
8 0.57
9 0.55
10 0.6
11 0.56
12 0.51
13 0.45
14 0.41
15 0.36
16 0.33
17 0.3
18 0.24
19 0.24
20 0.24
21 0.23
22 0.19
23 0.19
24 0.18
25 0.16
26 0.15
27 0.13
28 0.12
29 0.1
30 0.11
31 0.12
32 0.13
33 0.14
34 0.15
35 0.17
36 0.19
37 0.26
38 0.29
39 0.31
40 0.34
41 0.37
42 0.37
43 0.36
44 0.34
45 0.27
46 0.22
47 0.2
48 0.19
49 0.15
50 0.14
51 0.17
52 0.17
53 0.17
54 0.22
55 0.22
56 0.21
57 0.2
58 0.21
59 0.19
60 0.27
61 0.33
62 0.35
63 0.4
64 0.43
65 0.45
66 0.48
67 0.47
68 0.46
69 0.46
70 0.47
71 0.52
72 0.52
73 0.57
74 0.54
75 0.53
76 0.51
77 0.51
78 0.52
79 0.49
80 0.55
81 0.57
82 0.66
83 0.73
84 0.76
85 0.77
86 0.78
87 0.79
88 0.79
89 0.78
90 0.74
91 0.74
92 0.74
93 0.76
94 0.76
95 0.75
96 0.75
97 0.76
98 0.8
99 0.78
100 0.81
101 0.81
102 0.82
103 0.86
104 0.83
105 0.85
106 0.81
107 0.82