Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DL79

Protein Details
Accession J9DL79    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
135-160FLTNKYRPNYFKKKVFYKKRDLKLNKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11, cyto 1, plas 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKMFLLLCVFYGFLKATGYNKYPNPSLKSNFTTAKEFKKICLDHNEQAATTFHDLYTNCYESVMQCMPNSNQLILETAAFQTANFLIKSRLEQLSIGMDIEYSQATKQLDRNLSKMISLILKRDIMLCGTFSQSFLTNKYRPNYFKKKVFYKKRDLKLNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.19
5 0.22
6 0.26
7 0.29
8 0.33
9 0.36
10 0.41
11 0.45
12 0.46
13 0.48
14 0.5
15 0.5
16 0.51
17 0.52
18 0.48
19 0.5
20 0.47
21 0.5
22 0.5
23 0.47
24 0.44
25 0.47
26 0.46
27 0.44
28 0.48
29 0.48
30 0.44
31 0.48
32 0.46
33 0.37
34 0.37
35 0.32
36 0.26
37 0.21
38 0.17
39 0.12
40 0.14
41 0.14
42 0.17
43 0.21
44 0.2
45 0.18
46 0.18
47 0.18
48 0.16
49 0.2
50 0.17
51 0.13
52 0.12
53 0.14
54 0.14
55 0.19
56 0.2
57 0.15
58 0.14
59 0.13
60 0.14
61 0.12
62 0.12
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.05
69 0.05
70 0.07
71 0.06
72 0.07
73 0.07
74 0.08
75 0.1
76 0.12
77 0.13
78 0.12
79 0.12
80 0.12
81 0.13
82 0.13
83 0.12
84 0.08
85 0.07
86 0.06
87 0.07
88 0.06
89 0.05
90 0.05
91 0.07
92 0.08
93 0.1
94 0.13
95 0.19
96 0.27
97 0.29
98 0.31
99 0.32
100 0.31
101 0.3
102 0.27
103 0.22
104 0.2
105 0.19
106 0.19
107 0.19
108 0.19
109 0.19
110 0.2
111 0.19
112 0.15
113 0.15
114 0.14
115 0.12
116 0.15
117 0.15
118 0.14
119 0.15
120 0.17
121 0.18
122 0.2
123 0.27
124 0.28
125 0.34
126 0.38
127 0.44
128 0.47
129 0.55
130 0.62
131 0.64
132 0.69
133 0.72
134 0.79
135 0.82
136 0.87
137 0.86
138 0.87
139 0.88
140 0.89