Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0W616

Protein Details
Accession G0W616    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKKRASNGRNKKGRGHVNPBasic
80-112HARIVRVRSRENRKNRAPPQRPRFNRENKVSPAHydrophilic
NLS Segment(s)
PositionSequence
3-15KKRASNGRNKKGR
86-109VRSRENRKNRAPPQRPRFNRENKV
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ndi:NDAI_0B01920  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVNPVRCVNCSKCVPKDKAIKRMAIRNIVEAAAVRDLSEASVYAEYALPKTYNKLHYCVSCAIHARIVRVRSRENRKNRAPPQRPRFNRENKVSPADAAKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.77
4 0.74
5 0.73
6 0.77
7 0.76
8 0.69
9 0.6
10 0.57
11 0.5
12 0.49
13 0.47
14 0.46
15 0.47
16 0.53
17 0.56
18 0.59
19 0.66
20 0.66
21 0.7
22 0.67
23 0.66
24 0.61
25 0.64
26 0.61
27 0.58
28 0.51
29 0.43
30 0.4
31 0.33
32 0.29
33 0.21
34 0.17
35 0.1
36 0.09
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.04
43 0.04
44 0.05
45 0.04
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.07
53 0.09
54 0.13
55 0.2
56 0.21
57 0.24
58 0.27
59 0.27
60 0.3
61 0.32
62 0.29
63 0.24
64 0.26
65 0.24
66 0.25
67 0.24
68 0.24
69 0.25
70 0.27
71 0.29
72 0.3
73 0.37
74 0.43
75 0.52
76 0.59
77 0.65
78 0.71
79 0.76
80 0.83
81 0.85
82 0.87
83 0.86
84 0.88
85 0.88
86 0.89
87 0.87
88 0.84
89 0.85
90 0.84
91 0.84
92 0.82
93 0.8
94 0.76
95 0.75
96 0.69
97 0.61
98 0.59
99 0.55