Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9A0A1

Protein Details
Accession J9A0A1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-126VDNTLRKSKEKVPSVRKHKKLRIITDEKHydrophilic
NLS Segment(s)
PositionSequence
52-120RRKEAAEKEKEEKKRKERLLERKIARGRAKHAAKMERRLNRLKAQKDVDNTLRKSKEKVPSVRKHKKLR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MGRQRFDCNVEKTDIELETKLNKQATKDVSKYFNFMHEGGNEIYRKIEENMRRKEAAEKEKEEKKRKERLLERKIARGRAKHAAKMERRLNRLKAQKDVDNTLRKSKEKVPSVRKHKKLRIITDEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.26
3 0.21
4 0.2
5 0.21
6 0.23
7 0.26
8 0.26
9 0.26
10 0.26
11 0.33
12 0.38
13 0.41
14 0.42
15 0.43
16 0.46
17 0.45
18 0.46
19 0.39
20 0.36
21 0.31
22 0.28
23 0.26
24 0.2
25 0.22
26 0.19
27 0.22
28 0.19
29 0.16
30 0.16
31 0.13
32 0.15
33 0.13
34 0.19
35 0.24
36 0.33
37 0.39
38 0.43
39 0.43
40 0.42
41 0.48
42 0.49
43 0.49
44 0.46
45 0.44
46 0.46
47 0.53
48 0.61
49 0.63
50 0.64
51 0.63
52 0.67
53 0.67
54 0.71
55 0.73
56 0.76
57 0.76
58 0.77
59 0.71
60 0.71
61 0.7
62 0.68
63 0.63
64 0.55
65 0.51
66 0.51
67 0.52
68 0.47
69 0.5
70 0.51
71 0.52
72 0.58
73 0.61
74 0.58
75 0.61
76 0.63
77 0.62
78 0.62
79 0.65
80 0.61
81 0.6
82 0.59
83 0.58
84 0.56
85 0.57
86 0.57
87 0.56
88 0.55
89 0.56
90 0.57
91 0.53
92 0.54
93 0.55
94 0.56
95 0.57
96 0.64
97 0.66
98 0.71
99 0.8
100 0.86
101 0.88
102 0.89
103 0.89
104 0.89
105 0.88
106 0.87