Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8ZQ27

Protein Details
Accession J8ZQ27    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-33ARASKGPNKKTQKIAKKVDKKVIKRNKDKMIDHydrophilic
NLS Segment(s)
PositionSequence
5-28SKGPNKKTQKIAKKVDKKVIKRNK
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012617  AATF_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08164  TRAUB  
Amino Acid Sequences MARASKGPNKKTQKIAKKVDKKVIKRNKDKMIDFDIKEDLEGFFTTDGAYKWSCEKIDVFFDSLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.85
4 0.85
5 0.86
6 0.86
7 0.85
8 0.81
9 0.82
10 0.82
11 0.81
12 0.81
13 0.82
14 0.81
15 0.8
16 0.74
17 0.68
18 0.65
19 0.6
20 0.51
21 0.44
22 0.36
23 0.28
24 0.26
25 0.22
26 0.14
27 0.09
28 0.09
29 0.07
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.09
36 0.09
37 0.1
38 0.13
39 0.16
40 0.17
41 0.18
42 0.19
43 0.2
44 0.26
45 0.27
46 0.27