Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZWK6

Protein Details
Accession A0A178ZWK6   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-85DFDKSRERPERPKRQEPNEDRPHERSLRQRIKDKVKKILGBasic
NLS Segment(s)
PositionSequence
51-87RERPERPKRQEPNEDRPHERSLRQRIKDKVKKILGLK
Subcellular Location(s) nucl 21.5, cyto_nucl 16
Family & Domain DBs
Amino Acid Sequences MSSSQQDRGRGSGSNRPSSNIQAALGVNQETDTIRPRGYGDDRYSDFDKSRERPERPKRQEPNEDRPHERSLRQRIKDKVKKILGLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.44
4 0.45
5 0.44
6 0.44
7 0.36
8 0.29
9 0.23
10 0.23
11 0.2
12 0.19
13 0.14
14 0.1
15 0.09
16 0.09
17 0.07
18 0.08
19 0.11
20 0.11
21 0.11
22 0.11
23 0.12
24 0.16
25 0.19
26 0.24
27 0.22
28 0.26
29 0.27
30 0.31
31 0.31
32 0.28
33 0.26
34 0.23
35 0.26
36 0.24
37 0.32
38 0.37
39 0.4
40 0.5
41 0.6
42 0.69
43 0.72
44 0.8
45 0.79
46 0.8
47 0.87
48 0.84
49 0.85
50 0.84
51 0.81
52 0.75
53 0.71
54 0.69
55 0.62
56 0.59
57 0.57
58 0.58
59 0.63
60 0.65
61 0.69
62 0.72
63 0.79
64 0.83
65 0.81
66 0.8
67 0.77