Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DRL3

Protein Details
Accession J9DRL3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
81-106MNSASLKKIKKNKKYSAKNNKKLMISHydrophilic
NLS Segment(s)
PositionSequence
78-102KKFMNSASLKKIKKNKKYSAKNNKK
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHLEFKFFTKKAFKILLYFLNHFKYIDDSFFNNYIPLCVNLRIYKQFQKKSSTVIFFKIYLCLYIKTNFLVLFLKKLKKFMNSASLKKIKKNKKYSAKNNKKLMISDHRYSKNHIFFPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.44
4 0.42
5 0.43
6 0.41
7 0.38
8 0.37
9 0.33
10 0.29
11 0.26
12 0.22
13 0.22
14 0.2
15 0.19
16 0.22
17 0.22
18 0.22
19 0.18
20 0.17
21 0.15
22 0.14
23 0.14
24 0.12
25 0.12
26 0.15
27 0.16
28 0.19
29 0.22
30 0.25
31 0.32
32 0.39
33 0.44
34 0.46
35 0.5
36 0.48
37 0.49
38 0.51
39 0.47
40 0.4
41 0.37
42 0.34
43 0.29
44 0.28
45 0.24
46 0.18
47 0.14
48 0.14
49 0.12
50 0.12
51 0.13
52 0.13
53 0.12
54 0.13
55 0.11
56 0.11
57 0.13
58 0.11
59 0.15
60 0.2
61 0.26
62 0.25
63 0.3
64 0.32
65 0.33
66 0.36
67 0.35
68 0.4
69 0.41
70 0.44
71 0.49
72 0.55
73 0.53
74 0.58
75 0.63
76 0.63
77 0.67
78 0.74
79 0.75
80 0.77
81 0.86
82 0.9
83 0.92
84 0.93
85 0.92
86 0.91
87 0.87
88 0.79
89 0.71
90 0.68
91 0.67
92 0.63
93 0.6
94 0.61
95 0.62
96 0.61
97 0.65
98 0.66
99 0.63