Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DLZ1

Protein Details
Accession J9DLZ1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-37FDNSTVKKSQNKKNKKDKKNDEVDSDHydrophilic
NLS Segment(s)
PositionSequence
23-29KKNKKDK
Subcellular Location(s) nucl 16, cyto_nucl 12.333, cyto 6.5, cyto_pero 4.666, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MSKIKNDIDNIFDNSTVKKSQNKKNKKDKKNDEVDSDEDFSLRGKEMPRKYTEDGFPIYSLKELGLGNSQGETELCPFDCDCCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.24
4 0.23
5 0.27
6 0.35
7 0.44
8 0.54
9 0.63
10 0.7
11 0.79
12 0.86
13 0.88
14 0.91
15 0.91
16 0.91
17 0.9
18 0.84
19 0.78
20 0.71
21 0.63
22 0.55
23 0.46
24 0.36
25 0.25
26 0.21
27 0.16
28 0.12
29 0.1
30 0.09
31 0.09
32 0.17
33 0.22
34 0.26
35 0.3
36 0.35
37 0.37
38 0.41
39 0.4
40 0.36
41 0.34
42 0.3
43 0.28
44 0.23
45 0.2
46 0.16
47 0.14
48 0.1
49 0.11
50 0.09
51 0.1
52 0.13
53 0.13
54 0.13
55 0.13
56 0.13
57 0.11
58 0.11
59 0.11
60 0.1
61 0.11
62 0.12
63 0.13
64 0.14