Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DAF7

Protein Details
Accession J9DAF7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
169-195IYGNGKVKIKKKSNNFHKRIIPKRFLCHydrophilic
NLS Segment(s)
PositionSequence
176-182KIKKKSN
Subcellular Location(s) nucl 8.5, mito 6, cyto_nucl 6, pero 5, cyto 2.5, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MITIDLDEKINTETPLWFIIEQKLIKIYDDIRLVDAIKSQMNDKKPPVILTLVTVHYLNNFKKLLFGRMIKFKSKIDLLSKNSIENGLKDCRIIKCIQYMIDDGFLMFFCMFLIVKKVLYDECESQLIFCTAWGLDLNSVRMLEMLIIQVMDYKFNITLKTVKESIYDIYGNGKVKIKKKSNNFHKRIIPKRFLCAFDKMFSNIPCYKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.16
5 0.16
6 0.19
7 0.24
8 0.24
9 0.23
10 0.26
11 0.24
12 0.24
13 0.25
14 0.22
15 0.22
16 0.25
17 0.24
18 0.21
19 0.22
20 0.22
21 0.2
22 0.21
23 0.17
24 0.15
25 0.15
26 0.19
27 0.23
28 0.27
29 0.33
30 0.33
31 0.37
32 0.37
33 0.38
34 0.36
35 0.33
36 0.28
37 0.25
38 0.26
39 0.2
40 0.19
41 0.18
42 0.15
43 0.16
44 0.21
45 0.19
46 0.2
47 0.2
48 0.19
49 0.24
50 0.26
51 0.27
52 0.27
53 0.3
54 0.3
55 0.38
56 0.41
57 0.4
58 0.41
59 0.37
60 0.36
61 0.34
62 0.34
63 0.32
64 0.36
65 0.37
66 0.42
67 0.42
68 0.38
69 0.36
70 0.34
71 0.28
72 0.21
73 0.21
74 0.16
75 0.16
76 0.16
77 0.18
78 0.17
79 0.19
80 0.19
81 0.17
82 0.17
83 0.19
84 0.19
85 0.18
86 0.18
87 0.16
88 0.15
89 0.13
90 0.09
91 0.08
92 0.07
93 0.06
94 0.05
95 0.04
96 0.03
97 0.04
98 0.04
99 0.04
100 0.07
101 0.07
102 0.07
103 0.07
104 0.08
105 0.08
106 0.1
107 0.13
108 0.12
109 0.14
110 0.15
111 0.14
112 0.14
113 0.14
114 0.13
115 0.1
116 0.08
117 0.07
118 0.06
119 0.06
120 0.07
121 0.06
122 0.08
123 0.09
124 0.1
125 0.1
126 0.1
127 0.09
128 0.09
129 0.08
130 0.06
131 0.06
132 0.05
133 0.04
134 0.04
135 0.04
136 0.08
137 0.08
138 0.08
139 0.08
140 0.09
141 0.1
142 0.11
143 0.12
144 0.11
145 0.16
146 0.17
147 0.23
148 0.23
149 0.22
150 0.23
151 0.24
152 0.23
153 0.22
154 0.2
155 0.15
156 0.18
157 0.21
158 0.21
159 0.22
160 0.27
161 0.3
162 0.36
163 0.46
164 0.52
165 0.56
166 0.65
167 0.74
168 0.79
169 0.84
170 0.83
171 0.82
172 0.82
173 0.84
174 0.84
175 0.83
176 0.82
177 0.74
178 0.78
179 0.75
180 0.7
181 0.63
182 0.61
183 0.55
184 0.48
185 0.48
186 0.42
187 0.42
188 0.38
189 0.4