Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179A2G1

Protein Details
Accession A0A179A2G1    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
239-265ISSKWRACLRKAKRKSQKVGNDPSQAEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20.5, cyto_nucl 12.833, cyto_mito 11.666, nucl 3
Family & Domain DBs
Amino Acid Sequences MHLLVSFNVILDCLMGCTSGAVKALEAGRPTGAARMLHFRTLDWSMDPLRSIIVQLEFVRSRSATPAEIVARSVTYVGFTGILTGVRQDLSLSLNFRGVHNAARRRDHARFYLHHLLVLLGYRPSISSILREYITPEDPEDDQCKTLQEISDELIPRHTTAAYLLFCDGVSAIVIEKDYETGVVRQSNTFIGVTNNDEEELGSSNEATPLAAQVSAKACAVRAGMEAIIEESRDRLDAISSKWRACLRKAKRKSQKVGNDPSQAERNLAITTDVVIDWVSAYPTTNEQTHFATLMDPLNGRVVWTRIYPEAVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.08
6 0.08
7 0.1
8 0.1
9 0.09
10 0.13
11 0.15
12 0.17
13 0.18
14 0.17
15 0.16
16 0.17
17 0.17
18 0.16
19 0.18
20 0.16
21 0.17
22 0.25
23 0.26
24 0.29
25 0.29
26 0.26
27 0.28
28 0.29
29 0.29
30 0.21
31 0.23
32 0.21
33 0.22
34 0.22
35 0.17
36 0.16
37 0.14
38 0.14
39 0.13
40 0.12
41 0.14
42 0.14
43 0.2
44 0.2
45 0.2
46 0.22
47 0.2
48 0.2
49 0.2
50 0.22
51 0.17
52 0.17
53 0.21
54 0.2
55 0.2
56 0.2
57 0.17
58 0.15
59 0.14
60 0.13
61 0.09
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.07
68 0.07
69 0.07
70 0.06
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.08
78 0.1
79 0.12
80 0.12
81 0.15
82 0.15
83 0.16
84 0.18
85 0.17
86 0.21
87 0.27
88 0.34
89 0.35
90 0.39
91 0.43
92 0.46
93 0.5
94 0.48
95 0.46
96 0.44
97 0.41
98 0.46
99 0.52
100 0.45
101 0.41
102 0.36
103 0.31
104 0.26
105 0.24
106 0.16
107 0.06
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.08
115 0.1
116 0.12
117 0.12
118 0.12
119 0.13
120 0.15
121 0.16
122 0.15
123 0.14
124 0.13
125 0.14
126 0.16
127 0.16
128 0.14
129 0.13
130 0.13
131 0.13
132 0.12
133 0.13
134 0.11
135 0.1
136 0.09
137 0.1
138 0.13
139 0.13
140 0.13
141 0.13
142 0.12
143 0.12
144 0.12
145 0.11
146 0.07
147 0.07
148 0.11
149 0.09
150 0.1
151 0.1
152 0.09
153 0.09
154 0.09
155 0.08
156 0.04
157 0.04
158 0.03
159 0.03
160 0.03
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.05
167 0.05
168 0.06
169 0.08
170 0.1
171 0.11
172 0.11
173 0.12
174 0.12
175 0.12
176 0.12
177 0.1
178 0.09
179 0.1
180 0.12
181 0.11
182 0.11
183 0.1
184 0.1
185 0.09
186 0.09
187 0.09
188 0.08
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.06
195 0.05
196 0.05
197 0.05
198 0.06
199 0.06
200 0.08
201 0.09
202 0.1
203 0.11
204 0.1
205 0.1
206 0.11
207 0.11
208 0.1
209 0.09
210 0.09
211 0.09
212 0.08
213 0.08
214 0.08
215 0.08
216 0.07
217 0.07
218 0.06
219 0.06
220 0.07
221 0.07
222 0.06
223 0.08
224 0.11
225 0.15
226 0.24
227 0.27
228 0.27
229 0.32
230 0.37
231 0.38
232 0.42
233 0.49
234 0.51
235 0.59
236 0.68
237 0.74
238 0.8
239 0.87
240 0.89
241 0.89
242 0.88
243 0.87
244 0.88
245 0.85
246 0.82
247 0.74
248 0.69
249 0.64
250 0.54
251 0.46
252 0.36
253 0.29
254 0.22
255 0.2
256 0.16
257 0.11
258 0.11
259 0.11
260 0.09
261 0.08
262 0.08
263 0.07
264 0.07
265 0.07
266 0.08
267 0.07
268 0.08
269 0.09
270 0.12
271 0.16
272 0.18
273 0.19
274 0.21
275 0.23
276 0.24
277 0.23
278 0.2
279 0.18
280 0.18
281 0.18
282 0.18
283 0.15
284 0.15
285 0.17
286 0.17
287 0.17
288 0.18
289 0.18
290 0.18
291 0.2
292 0.23
293 0.22