Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178Z7R9

Protein Details
Accession A0A178Z7R9   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
109-133KSGSGSKKMAKRQQLNYRPWRKVMKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 8.5, mito 6, extr 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002889  WSC_carb-bd  
Pfam View protein in Pfam  
PF01822  WSC  
PROSITE View protein in PROSITE  
PS51212  WSC  
Amino Acid Sequences MPASAPASSGAPSTSNPSWSYTGCFTDAVNPRTLPQWSNFNGPNMSNAACVSFCDSRGYTIAGTEYAGQCFCGDEITTPQLDEGSCNMACTGAAGEMCGGPGAFSLWTKSGSGSKKMAKRQQLNYRPWRKVMKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.21
4 0.24
5 0.26
6 0.25
7 0.28
8 0.24
9 0.25
10 0.24
11 0.23
12 0.19
13 0.26
14 0.32
15 0.31
16 0.31
17 0.29
18 0.28
19 0.31
20 0.32
21 0.25
22 0.2
23 0.26
24 0.25
25 0.3
26 0.31
27 0.31
28 0.31
29 0.3
30 0.28
31 0.22
32 0.21
33 0.15
34 0.13
35 0.12
36 0.1
37 0.1
38 0.12
39 0.11
40 0.11
41 0.13
42 0.14
43 0.14
44 0.15
45 0.15
46 0.11
47 0.11
48 0.1
49 0.08
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.07
63 0.09
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.07
71 0.1
72 0.1
73 0.1
74 0.1
75 0.09
76 0.09
77 0.09
78 0.08
79 0.05
80 0.05
81 0.05
82 0.06
83 0.05
84 0.06
85 0.05
86 0.05
87 0.03
88 0.04
89 0.05
90 0.05
91 0.05
92 0.07
93 0.09
94 0.1
95 0.11
96 0.12
97 0.19
98 0.22
99 0.27
100 0.31
101 0.38
102 0.44
103 0.54
104 0.61
105 0.64
106 0.69
107 0.75
108 0.79
109 0.81
110 0.84
111 0.85
112 0.87
113 0.82
114 0.8