Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DFY7

Protein Details
Accession J9DFY7    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
68-98LEILKKGNDKRCKKFLKKRIGNMKRTRAKLSHydrophilic
NLS Segment(s)
PositionSequence
72-96KKGNDKRCKKFLKKRIGNMKRTRAK
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MSLPEKPREPKTGYAFGKNKGHTVKPLPKRRFANIHQYKPHKTSESVKLARSVAAEICGLAPYEKKALEILKKGNDKRCKKFLKKRIGNMKRTRAKLSQLQSKAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.61
3 0.61
4 0.64
5 0.56
6 0.55
7 0.49
8 0.48
9 0.44
10 0.5
11 0.53
12 0.55
13 0.65
14 0.64
15 0.68
16 0.7
17 0.7
18 0.69
19 0.64
20 0.65
21 0.64
22 0.68
23 0.68
24 0.69
25 0.67
26 0.62
27 0.62
28 0.53
29 0.46
30 0.43
31 0.44
32 0.47
33 0.45
34 0.43
35 0.41
36 0.39
37 0.36
38 0.3
39 0.22
40 0.12
41 0.11
42 0.1
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.08
51 0.08
52 0.08
53 0.1
54 0.14
55 0.19
56 0.23
57 0.27
58 0.33
59 0.4
60 0.45
61 0.53
62 0.59
63 0.63
64 0.66
65 0.72
66 0.75
67 0.78
68 0.84
69 0.84
70 0.86
71 0.87
72 0.89
73 0.9
74 0.9
75 0.89
76 0.89
77 0.9
78 0.87
79 0.82
80 0.79
81 0.73
82 0.7
83 0.68
84 0.67
85 0.67