Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZJM8

Protein Details
Accession A0A178ZJM8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-73STANQSDKEKAKKHKRHWWSRFRKSDGRPCREBasic
NLS Segment(s)
PositionSequence
50-65EKAKKHKRHWWSRFRK
Subcellular Location(s) nucl 9, mito 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MPAAVPSMSIAPLIVTSTTGTTIQTLDYLTGETSVMSTTMMSTANQSDKEKAKKHKRHWWSRFRKSDGRPCREMQTLETTAAHRSRSSSRSPRPLDESMFPRRISNNSSQSVPTPPVNITATPASPSSVASSISSCSNSSIFGSETSRTTTGGGRSSTSSIYPSRVSPSASTKGAAGVNESLGTKAIMKEQTKKSQGYRERRSLMGDPALDALMLSSAFVIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.08
5 0.1
6 0.1
7 0.1
8 0.1
9 0.1
10 0.1
11 0.1
12 0.1
13 0.09
14 0.09
15 0.09
16 0.08
17 0.08
18 0.08
19 0.07
20 0.07
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.06
27 0.07
28 0.07
29 0.09
30 0.12
31 0.15
32 0.18
33 0.2
34 0.24
35 0.31
36 0.39
37 0.45
38 0.52
39 0.6
40 0.68
41 0.76
42 0.81
43 0.84
44 0.88
45 0.91
46 0.91
47 0.91
48 0.92
49 0.91
50 0.88
51 0.87
52 0.84
53 0.84
54 0.84
55 0.8
56 0.74
57 0.66
58 0.64
59 0.58
60 0.51
61 0.43
62 0.4
63 0.34
64 0.3
65 0.29
66 0.25
67 0.24
68 0.25
69 0.22
70 0.15
71 0.16
72 0.2
73 0.23
74 0.3
75 0.37
76 0.42
77 0.51
78 0.54
79 0.54
80 0.55
81 0.54
82 0.49
83 0.43
84 0.42
85 0.39
86 0.39
87 0.36
88 0.31
89 0.3
90 0.29
91 0.29
92 0.31
93 0.31
94 0.29
95 0.3
96 0.29
97 0.29
98 0.29
99 0.27
100 0.19
101 0.15
102 0.13
103 0.15
104 0.15
105 0.14
106 0.14
107 0.13
108 0.13
109 0.12
110 0.12
111 0.1
112 0.09
113 0.1
114 0.09
115 0.09
116 0.09
117 0.09
118 0.09
119 0.1
120 0.11
121 0.11
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.1
128 0.09
129 0.1
130 0.12
131 0.12
132 0.13
133 0.15
134 0.15
135 0.14
136 0.15
137 0.16
138 0.17
139 0.19
140 0.19
141 0.18
142 0.19
143 0.2
144 0.19
145 0.17
146 0.18
147 0.15
148 0.17
149 0.17
150 0.17
151 0.2
152 0.21
153 0.22
154 0.22
155 0.27
156 0.29
157 0.29
158 0.28
159 0.24
160 0.25
161 0.25
162 0.22
163 0.18
164 0.14
165 0.13
166 0.14
167 0.14
168 0.11
169 0.1
170 0.11
171 0.09
172 0.09
173 0.14
174 0.2
175 0.23
176 0.32
177 0.4
178 0.49
179 0.53
180 0.57
181 0.58
182 0.62
183 0.68
184 0.7
185 0.71
186 0.72
187 0.7
188 0.67
189 0.67
190 0.61
191 0.57
192 0.53
193 0.43
194 0.35
195 0.32
196 0.3
197 0.24
198 0.19
199 0.13
200 0.08
201 0.07
202 0.06