Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DUU5

Protein Details
Accession J9DUU5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKKNDKKPKVKCKAEVLNSLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR010997  HRDC-like_sf  
IPR005574  Rpb4/RPC9  
IPR038324  Rpb4/RPC9_sf  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005634  C:nucleus  
GO:0000166  F:nucleotide binding  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF03874  RNA_pol_Rpb4  
Amino Acid Sequences MKKNDKKPKVKCKAEVLNSLKNREYYETEETMCVSKAIEEYCEECVPFEKIKFIKAELRAKKLFDIEIYQLLELWPKSLLCLQLVIEEMEERYTEEELNYILMLFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.78
4 0.77
5 0.71
6 0.68
7 0.6
8 0.51
9 0.46
10 0.39
11 0.37
12 0.33
13 0.34
14 0.32
15 0.3
16 0.29
17 0.28
18 0.25
19 0.21
20 0.15
21 0.1
22 0.08
23 0.09
24 0.09
25 0.09
26 0.09
27 0.1
28 0.13
29 0.14
30 0.13
31 0.11
32 0.12
33 0.14
34 0.14
35 0.13
36 0.15
37 0.15
38 0.17
39 0.18
40 0.18
41 0.21
42 0.27
43 0.36
44 0.35
45 0.41
46 0.41
47 0.41
48 0.4
49 0.36
50 0.3
51 0.22
52 0.21
53 0.16
54 0.18
55 0.18
56 0.16
57 0.15
58 0.14
59 0.15
60 0.12
61 0.11
62 0.08
63 0.08
64 0.09
65 0.11
66 0.13
67 0.11
68 0.12
69 0.12
70 0.13
71 0.14
72 0.13
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.08
79 0.09
80 0.1
81 0.1
82 0.09
83 0.1
84 0.09
85 0.1
86 0.09